ELF0]@4 P4 (44@4@@@p((@(@@@ܺ ܺ  A@ @@@@@f[f[Ptd JJ/lib/ld-uClibc.so.0 \@ 0I @p@@ @ 6 pP66ppp@ pppp  M7U|SQqB/ r1>#sFn5yY[? 8?61  cIV32Ft40]WNUovcAofymL=Q;g(rVPC+p% BT')`Ct@Z{Qb6$S{!,"9JY%DzcjjJ Tl^a"-idE)0!XjiS9PI.Cvx0HmsHgh=zXOD }:$8(kAL>%^V_+pn4sR<J473Eg\N2}RW5u\dk&&u Gf_;8&K*e$wYx*K@^#Gz~F[tqfw.~hbAih  b " 'Lw-*=M|r<]dB5-e~k:Ulm[a{W}T/]RuHq ,O)\(3.6lyZ!@v|/``xPI+E 9 K>e nO;_1ZM,GN? p#2X'<7D:oa @@ 0]@P6 $AA6@ 0A HcPo@]@o@8D0o@ o@0oI/o@o@ 3I`#F\n@ 06 @8 F LBV5 1  tn@A8ACAp@ NI`j@H Pj@@j@7I0j@ j@WgItj@j@i@i@i@si@@5Bi@6 i@]Ai@^P2IUH@q@5i@pi@K `i@Z(\EPi@G@R @i@ F 0=AYsI0i@A0  i@ &IH@Dg@ g@g@ g@pg@xm jI`g@nC 6 AAoPg@ 6I @g@*0g@qI g@"g@g@f@f@Wf@AqLBD7Df@f@Ff@ f@13F$5 PD 7I@Is f@pf@ `f@$Pf@BDE @f@C  gI(A0f@5 RDx aDN@H f@`8If@f@ZEe@ sACe@be@Ne@e@ Ce@ pEHe@e@ Cpe@MAuė@)`e@Pe@Eq@w@e@m0e@MI, e@e@ p(AA#v@ e@d@e P]d@d@B7Fd@ b@ b@7b@b@pb@PL FhHpb@m 1I`b@ ABPb@F:(I4 @b@_ 0HqI @J 0b@{(F oI b@?b@ 1IP KB\b@GESQIa@(6Fa@TXHa@a@n,AUFHa@ a@a@ a@pa@pPI`a@eBwPa@nH@a@ 0UI7@eI0a@4HXxEp?AЯH a@a@@FaAa@`@0PHHzJB A`@`@e`@9 `@CA`@+`@`@ep`@``@l?I' @[P`@fAdIFCz 5 @`@X 5 0`@ `@K`@ `@ZI# HgH_@ _@@cI|H:rIMEQpH  I/k _@m_@fH.D8 _@dI|EA0H@B FB^@ 9IA^@E ^@d^@ pHsI^@^@`Ap^@ `^@4AyuIN 0VIP^@@^@0^@; `uI ^@^@i}@^@]@:F/]@F!E D ]@[A8EAz5A(4F]@ fI? ]@]@A ]@&`E+ @_fini__uClibc_start_main__deregister_frame_info__register_frame_info_Jv_RegisterClassesbb_applet_namerun_applet_by_namebb_error_msg_and_diebeen_there_done_thatget_terminal_width_heightstderrbb_msg_full_versionappletsfputsbb_strlenmemmovememsetusage_messagesstrcmpbsearchfind_applet_by_namebb_show_usagebusybox_maintest_mainash_mainawk_mainbasename_mainbunzip2_maincat_mainchmod_mainclear_maincmp_maincp_maincpio_maincrond_maincrontab_maincut_maindd_maindf_maindirname_maindmesg_maindu_mainecho_maingrep_mainenv_mainexpr_mainfalse_mainfind_mainfree_mainftpgetput_maingunzip_maingzip_mainhead_mainhexdump_mainhostid_mainhostname_mainifconfig_maininit_maininsmod_maininstall_mainkill_mainklogd_mainlength_mainln_mainlogger_mainlogname_mainlogread_mainls_mainlsmod_mainmd5sum_mainmkdir_mainmkfifo_mainmknod_mainmktemp_mainmore_mainmv_mainnc_mainnetstat_mainnslookup_mainpatch_mainpidof_mainping_mainprintf_mainps_mainpwd_mainrdate_mainrealpath_mainreboot_mainrenice_mainreset_mainrm_mainrmdir_mainrmmod_mainrun_parts_mainsed_mainsha1sum_mainsort_mainstrings_mainstty_mainsysctl_mainsyslogd_maintail_maintar_maintee_maintelnetd_maintftp_maintop_maintouch_maintr_maintraceroute_maintrue_mainumount_mainuname_mainuniq_mainuptime_mainusleep_mainvi_mainwc_mainwget_mainwhich_mainxargs_mainyes_mainbb_getopt_ulflagsoptindbb_xopenisattybb_xstrndupuncompressStreamunlinkinit_handleseek_by_charheader_listdata_extract_allheader_verbose_listseek_by_jumpfilter_accept_listllist_add_toget_header_cpiobb_xstrdupstrrchrbb_xread_charcheck_header_gzipinflate_gunzipfputcbb_perror_nomsggetoptxcallocfstatbb_perror_msg_and_diexmallocstrcpystrcatfchmodbb_error_msgbb_perror_msgmemcpybb_msg_name_longer_than_foofnmatchbb_copyfd_eofbb_xfopenbb_get_chomped_line_from_filefcloseuncompressopen_transformerget_header_tarbb_xasprintfbb_opt_complementalybb_applet_long_optionsdata_extract_to_stdoutget_header_tar_gzget_header_tar_bz2last_char_isfilter_accept_reject_listfilenochdirfind_list_entrymy_getpwuidmy_getgrgidxreadlinkbb_full_writebb_msg_io_errorpipevforkdup2fcntlexecl__errno_locationbb_full_readrecursive_actionwaitpiddirnamebb_make_directorylstatdata_skipbb_copyfd_sizemkdirsymlinkmknodlchownutimelocaltimebb_mode_stringlseekheader_skipfilter_accept_alllongjmp_setjmpdata_alignarchive_xread_all_eofstrncmpsscanfarchive_xread_allbb_xread_allbb_xreadgunzip_crcgunzip_bytes_outinflate_unzipconcat_path_fileinbufmaxbitsblock_modecodetabhtabsafe_readoutbufbb_get_last_path_componentbb_fflush_stdout_and_exitbb_wfopen_inputbb_fclose_nonstdinbb_parse_modebb_default_error_retvalbb_xferrorbb_xfflush_stdoutbb_fprintfcp_mv_stat2cp_mv_statcopy_filestrsepxreallocqsortputcharstrchrbb_wfopenbb_msg_invalid_dateputenvmktimebb_msg_memory_exhaustedstimestrftimebb_xparse_numberbb_msg_standard_inputftruncatebb_msg_standard_outputbb_printfbb_path_mtab_filesetmntentgetmntentendmntentfind_mount_pointstatfs__divdi3find_real_root_device_namemake_human_readable_stris_in_ino_dev_hashtableadd_to_ino_dev_hashtableopendirconcat_subpath_filereaddirclosedirgetenvbb_xgetularg10_bndbb_process_escape_sequenceunsetenvexecvpre_syntax_optionsre_compile_patternre_matchstrcspnoptargbb_xgetularg10bb_xferror_stdoutgethostidgetuidgetgidgeteuidgetegidsafe_strncpymy_getpwnamegidmy_getpwnammy_getgrnamget_ug_idumaskbasenameexeclpis_directorygetloginctimeatoihash_fdstrstrhash_filesgetopt_mk_fifo_nodmkfifoaccessbb_ask_confirmationrenameremove_fileisdigitisxdigitbb_dump_skipbb_dump_fsheadbb_dump_vflagbb_dump_lengthbb_dump_addbb_dump_dump__ctype_bsafe_strtoulsafe_strtolsafe_strtodxgetcwdrealpathrmdirbb_xgetularg_bnd_sfxbb_perror_nomsg_and_diexgetoptfile_sort_uniqvsprintfopterrtcgetattrtcsetattrmemcmpcfsetispeedcfsetospeedioctlcfgetispeedcfgetospeedbb_baud_to_valuebb_value_to_baudbb_xgetlarg10_sfxsetbuffwritebb_skip_whitespacegetgroupsbb_msg_write_errorbb_warn_ignoring_argsttynameunameusleepmkdtempmkstempbb_xgetlarggetopt_longrun_partsxregcompregexec__ctype_toupper__ctype_tolowerstrpbrkregfreeatan2strncasecmppopenfflushcosexpsinsqrtsrandsystempclosepowstrcasecmpfreadstrerrorbb_get_line_from_fileoutnamestrspnpipelineregmatchpipe_putcappend_headappend_tailnonstdoutbb_xprint_and_close_fileadd_cmdatexitgetpidalarmkillselectstrncatnewer_mtimemsg_invalid_argmsg_req_argwaitgetcharvsnprintfopenlogcloselogdevice_opensysinfosigemptysetsigaddsetsigprocmasksetsidtcgetpgrpbb_default_login_shellexecvrebootsyncpausefgetskill_initvsyslogvdprintfdaemonchange_identity_e2strremovestrtokwait4perrorchange_identityfgetcwait3gettimeofdaygetpagesizeinit_modulefseekcreate_moduledelete_modulefscanfmy_query_modulesyscallxconnectfdopenbb_lookup_hostbb_lookup_portinet_ntoasethostnamechompgethostnamexgethostbynameinterface_opt_adisplay_interfacesbb_INET_defaultinet_atonip_parse_common_argsmatchesdo_ipaddrdo_iproutedo_iplinksetsockoptbindlistenacceptshutdowngetservbyportINET_rresolvefeofdisplayroutesgethostbyaddr__res_init_reshostentsendtocreate_icmp_socketrecvfromINET_resolvesysconfgrantptunlockptptsnametcsetpgrpprint_login_issuesetlinebufbb_msg_can_not_create_raw_socketinet_addrgetdomainnameclearerrbase64encfreopensetitimersigactioninvargpreferred_familyoneline_SL_parse_rtattrll_idx_n2all_index_to_flagsprint_link_flagsll_type_n2all_addr_n2artnl_sendinet_addr_matchll_index_to_namert_addr_n2artnl_rtscope_n2all_remember_indexcompare_string_arrayget_prefixrtnl_rtscope_a2nincomplete_commandduparg2rtnl_openrtnl_wilddump_requestrtnl_dump_filterll_name_to_indexaddattr_lget_addrdupargll_init_maprtnl_talkipaddr_list_or_flushgetsocknamell_addr_a2nget_integerrtnl_rtntype_n2aformat_host__iproute2_hz_internal__get_hzget_unsignedrta_addattr32rtnl_rtprot_a2nrtnl_rtntype_a2nsendmsgrecvmsgftellinet_ntopget_addr_1rtnl_rtrealm_a2ninet_ptonget_prefix_1u_signal_namesprocps_scanfind_pid_by_namegetprioritysetprioritytrimmult_lvl_cmpsigsetmaskraiseexecvemempcpykillpgsetpgidstrsignalgetppidstrchrnulstpcpyvprintfsigfillsetmemchrtimesgetrlimitsetrlimitcmdedit_path_lookupcmdedit_read_inputbb_msg_unknownklogctlfacilitynamesprioritynamesshmgetshmatsemgetsemopshmdtshmctlsemctlcirc_messagewritevipcsyslog_cleanupipcsyslog_initrecvbb_msg_perm_denied_are_you_rootbb_simplify_pathumountumount2vasprintfisspaceinitgroupsendgrentsetgidsetuidgetprotobynamebb_dump_blocksizebcmpbcopybb_dump_sizebb_verror_msgsafe_writesha1_end__udivdi3getnetbyname__h_errno_locationgetnetbyaddrget_kernel_revisionbb_vperror_msgalphasortscandirgetservbynamebb_herror_msg_and_dieregerrorbb_vfprintfbb_xgetlarg_bnd_sfxbb_xgetularg_bndbb_vherror_msgherror_DYNAMIC_LINKING__RLD_MAPlibm.so.0_gp_disp_DYNAMIC_GLOBAL_OFFSET_TABLE___clz_tablibc.so.0__environ_ftext_fdata_gp_edata__bss_start_fbss<Z'!'$!x =$!x <$!x ;$!x 6$!x 5$!x 2$!x 1$!x ,$!x )$!x '$!x %$!x #$!x !$!x  $!x $!x $!x $!x $!x $!x $!x $!x $!x  $!x  $!x $!x $!x $!x $!x $!x $!x $!x $!x $!x $!x $!x $!x $!x $!x $!x $!x $!x $!x $!x $!x $!x $!x $!x $!x $!x $!x $!x $!x $!x $!x $!x $!x $!x $!x $!x $!x $!x $!x $!x $!x $!x $!x $!x $!x $!x $!x $!x $!x $!x $!x $!x $!x $!x $!x $!x $!x $!x $!x $!x }$!x {$!x z$!x x$!x r$!x m$!x j$!x i$!x h$!x g$!x _$!x ]$!x [$!x Z$!x V$!x U$!x T$!x S$!x R$!x Q$!x O$!x N$!x L$!x F$!x C$!x B$!x A$!x @$!x ?$!x =$!x ;$!x 7$!x 4$!x 3$!x 0$!x .$!x -$!x *$!x ($!x '$!x &$!x $$!x #$!x "$!x $!x $!x $!x $!x $!x $!x $!x $!x  $!x $!x $!x $!x $!x $!x $!x $!x $!x $!x $!x $!x $!x $!x $!x $!x $!x $!x $!x $!x $!x $!x $!x $!x $!x $!x $!x $!x $!x $!x $!x $!x $!x $!x $!x $!x $!x $!x $!x $!x $!x $!x $!x $!x $!x $!x $!x $!x $!x $!x $!x $!x $!x $!x $!x {$!x x$!x u$!x t$!x p$!x o$!x n$!x l$!x i$!x e$!x a$!x `$!x ^$!x Z$!x S$!x R$!x P$!x N$!x M$!x G$!x F$!x C$!x A$!x @$!x >$!x <$!x 9$!x 6$!x 5$!x 4$!x 0$!x /$!x ,$!x )$!x ($!x '$!x !$!x $!x $!x $!x $!x $!x $!x $@$$ƌ+6@+/@! @Xjc$cPj$!Dc$E!8D$* $!$"$+0iXj!$#+$!$`"$$ƌ+@! @  'B*@>$!$ B+<$B*($B'( !`0'<@5'!' ($!!!$<9'  @! $<9' @/$ $ E$%$ +$ +$ $l !,*@-$*$ #/$ !@( !`0'<3'!'T!h\d!`XP$~9' ! $~9' &^$À b䂄 $ $ '$ @'! @!( $!@( !( $! ( @! @$؊ $<c4!(!0@ #4h  @!(@ `$l d$ e! @!0@!8쇙 !@8@! Hbc!C@DdB! @! d$$X}9' $}9'  !@l !h`\XTPp'<,1'!'j&$  h$< $9'  l$&@&j!$#(9'  l$!@$9' @jB$BB$j!$" !$9'  @& $l ! j!$"$X}9' !@!$('@$$9'  $1@=$$9'  $$@$9'  $@!$$9'  $ @$$9' H@>$jB$BB$j!$"(̐9' !@! @$<9' ! $<9' !0 !(! @(X9' ! @!@$}9' ! $}9' ! $}9' `!@!@( 0'bB&j!$"((9' +B,D!$-bB&)@B& D(.9' jB$B@C$bB&j!$"((9' +! @ DB&j!$"(.9' ! @(!9' jc$cP,b@!db$j!$" ! $(d!9' !( 0'<\'!'!0 @!(!( $l !( $l <ܔ'!'$ ((#9' !@jB$B!DB$j!$"(.9' $$j$C! $j!$"(.9' ! @(!9' @$! $j!$"$!('<'!'$ (h$9' !@jB$B!DB$j!$"(.9' #$j$C! $j!$"(.9' ! @((#9'  @! $! $j!$"$!('jB$B!(D(,9' /jB$BD(.9' jB$B@C$ b((9'  jB$BD$ + ('<'!'jB$B ($DC$j!$#P(.9' jB$BjR&RQB$j!$ "D $(d!9' BD$,@$ ,!$!""!\@! !( | B,! !( | +! !( | ! !( | *! (/9' ! !@(/9' &.! (/9' ! !@(/9' &q+! (/9' ! !@(/9' *]:! (/9' ! !@(/9' J*P! (/9' ! !@(/9' *P6B8! (/9' ! !@(/9' #*! !( (09' ! !( (419'  ! !( (19' $( 0'<ԉ'!H' $! !' R@4Z!'d R@!%&,B@ p!$!""!\@! $! $(t29' 7C,! $(4&@$$ $"`$ $4"$ $$H* 4 &bh 8&b c, $,B0&CC,,$C+!`'<'!'$  & !j!$ !!j!$0 B$B@! | @&@j!$ '$$('<'!'0($ !, @! @' $!@ !@@!(@ $ C `! !(@ $l 0($ 8'<$'!'8!'@<d ! '@!d  @!X*C@!$!@8H'<'!'8!'@<d ! '@!d  @!X*C@!$!@8H'<'!'8!'@<d ! '@!d  @!b!(b!$!@8H'\$ -$$('(@ !&;bH[$$+&*@!(!$*`&(B$$($($H(&($*`(!$*`&(B$((&(@#$('<%B4LHD<!%'<W!@!s6O!B2g@><m$C~<$b<$+b`!0$b1<"$ C~<$b+d`0"$m$%$0 b<B0 $C%s6<(tg9' <><B4 %4m$(o9' !@><B4$B! %s6@!><B4<#C%+r@<$BB.@<$B! `B<B! `B+R@<< B! `BB <@B! `'$m$l$(S9' @!@$bm$l$(U9' <$B@>< <%C$(q9'  ><B4m%'$$$ ! @ <$B@m$ƌm$(^9' O! `m$(\9' B! ` $$ m$!(!0@( p9' +! `$m$l$(U9'  $(q9' !@Q  " !(p9' ! `(tg9' !@$V@$TLHD@<840X'<%Ԅ4(tg9' !@B0@><b0 @><%4(o9' ({9' ><%4(tg9'  $C%B4$b @(o9' <B%4 (tg9' <C({9' lB$BB "(p9' ! !@(ty9' Q$(xw9' ! !@(ty9' !@B<"(tg9' (p9' $(tg9' @$(q9' !@mB$BB0,@$"B0 C< $(`R9' <4(xw9' !@ #" ! (ty9' !@#<B4(<4(xw9' Q@$(q9' $!@(q9' ! @(ty9' !@j Q$gm$(xw9' 4!@(q9' mB$BB0@4mc$c%C(q9'  mB$B B02@(o9' )(xw9' !@lB$B$(xw9' !@lB$B m$(x9' $('<4'!'$ m!$$m!$"?<0@@<lc$$l!$@#lB$<$ @ <lB$l!$"$k@><<(tg9' mB$Bm$l$B$m!$"(U9' !@@ @m$l$(U9' $!(`c$E(tg9' B0@&<4(tg9' <$C@&l!$"({9' l$(Z9' V?<%B4$B@(o9'  $(xw9' <Є4!@(q9' mB$BB0@$(o9' ({9'  (xw9' lB$B (o9' ({9' ?<%Ԅ4(tg9' ! @< ('<0'!'!!$ $ B,! !( @&( p9' !"!$('"FE<DDDD4!8D$ FDD! ` FDDDD4!8D FDD%bЃ  !@! `!$#  !0@! Ѓ  D!F D(D!0@(@! $F$DDDD2 F$E!@!!@0@DD @DD@  Ą!DDt(^9'   H$(`R9'  0C0b,@b,ޏ @lB$B@,(Le9'  t`\TPLHD@<8hlp'<'!'0kB$B ($@!l$$k$0k!$",D9' lc$cb#@!c!CP @쉙 lc$c1&b+"@! @ <'!'(0,$ Dc!@@!CBB0@_$ ! @! @=$,  @! @l 4!P$@@!'(PY9' "B@1& l$!(@(U9' ! @!((L]9' ! @l $0($ 8'<ߜ'!'l$$ (,l&! l!$ 4F E!lB$Bk@܅1L>!H!@\$ b!`!G)%!``$ b)%$!B)%$*&@!@<Ĝ'!'$ !! @0($,!؊ !@!(!0 ! @n$ $,49' !@0($ 8'!" $!(, D@!(b@c$b@c$ $L#@! E $b\$b1& B0@! 1&!  b! $ d!0@!(!8,49' ! $ !" $, *@!(b@b @!(  $l f&! `,x9' c!"w$b! d $؀ b $, *@y$"c@!CB B0 @! 1&"@!CB B0@!  ( $ @!@! !(@ !0bu!(!  '$'2,09'  !"Q$$  !8@!(!0@,49' $!@$ $!0@!(!8,49'  $ @B$!(@$  bb @!$B@!rbd@!bD$d!RB!db R&!rB@$!RB@!r l $l !  $,  @! !( !$l ! <40,(@'<'!'mB$B ($>@!! @$ ! @!@$ !B$! @؊ m$!@!0! @舙 !0 $!(@&Ԋ m$l m!$1! m!$ ! @$  @!@!BC\$bmB$B@!P! @p m!$"mB$B!P@B@! @ ( $l !BC`#$b$Cn$ b! @mB$BB$m!$" !$| }@!@$$  E$! @!0@!@,9' !BC,$b&R&! @&,9'  $!$;@!BBc@!CB B0 @R&B@!CB B0@C!$b<%CR&Bc@!CB B0 @R&B@!CB B0@BC @!  P!$l R&!(@,T9' !@B$B P!$0BZ@! @m$ l m!$ ( 0'< '!'䇃c䇂B&$ @e$䇐&b䇄Ą 䇂B@B$䇃c䇂B$!CQc$䇁#('<4'!'$,( _@!!#\$+b! #1b(&@:b($@b$!rc$Fb1&!RB*b>@!`!pD&< !RB*@!p,1&\$&$1&$B*@!pD&< B*@!p1&< 1&"@,$ 0'&%40$!8`, 9' $<B0c4$ % ($mB$B@!8`$ԁm$ƌ, 9' m!$" $l !  '.$! l !%! $$ ! !@$ !B$$!(@ !P $&!($Ԋ !  ' ,L 9' !@mB$BB$m!$"!$, 9' !@$B@!8#b@!0$!(f! Gb#$!fB@$$!GB@$l ! p !y$$$!$ P$! $ !@$!(Ą !@$$`$ !$l N!($l G!! l $p 9!@$!! $ P$$$ !@! !(Ą !@$ !$! l $ ! l $$!@! 17 mB$B@!8`$ԁm$ƌ, 9' m!$",@ 9' $l $l PLD@<840,(X'<'!'$ ,( !@$!@!  !$ !"@!!  `&! @l ,$ 0'<'!8'$!!!$ "$| v@ "$ ! b,@ #!$!""!\@mB$B,$B$m!$" N! mB$BB4m!$"B! mB$BB$m!$"6! `,9' )!` !$؀ !@!  ! !l !  @!@!  ! !(` "$4 @C$@􅃏c!SDb$ 􅁏",9'  "$ 􅆏ƌ! S\Bԁ"&`*mB$B@䂅 "$$ $ ܅,9' !@!! #$| @mB$B @܅,9' R& !$| @!@mB$Bg@! $ B$!(@ ! @ #$H"l !  ! @' HԂ H $| ! ԁ" ! @' ԁ ,! @x ,$ ! ,9' !  mB$B.@ԁ \Bԁ"$ H܆ Hl H R&$R&*T%@&!'<0'!'\$  '<䑜'!'!! Xp!$"$'n!$"tp!$ pp!$ #$$X  @$$pp!$"tp!$"$n!$"xpc$$B$`Ac$ $B$lp!$"! R$ bpp!$$tp!$$ ! ,|9' ]$!(  $$4 !@$b$􅂏B(n!$0*P$n!$"`$! n!$",'9' 4!n$$n!$"l 􅂏B!QD ! @n!$",'9' 􅂏BB$*P􅁏"`!'<Ԏ'!'@!<840,($ pthl`dX\PTHL09' $n$n$! n!$"P$n!$" n$n$,f9' ! 09' @ !@,h9' n$n!$%n!$%n!$% $! !00<9' @$n$ $,@k9' $p!$"$p!$" n!$ !&*p!$!" p$`nB$B]o!$ hl^o!$ n!$ n!$ 09' ! 09' ! 09' 0Ą$$p 0$$p ho$ ?@!(@$ $$$ $$$ 0$$$ <$$ $ H$$ $ T$$$ `$$ $$ $$09' nB$Bn!$"n!$"`p$$n!$"$n!$"n!$ ,n!$ n!$ l hp$l ! `p!$ hp!$ dp!$ \p!$ 0h9' 0,9' \ć nB$B@09' n$!@]o!$",h\9' nc$c8Cn$,h\9' n$n!$",h\9' n$!@,\9' p$ƌ!(@! ,9' \pB$B@! hpB$B@!( lp$, @! ,|9' ! 0|9' ! 0x9' @! 09' 0,9' nB$Ba@n$!(!00t9' 09' 0L9' @<40,($ pthl`dX\PTHLx''!' ,v9'  @! 049' $n&n!$"09' ($0x9' ! n!$009'  ('<='!' !!!($! 1@!( n$ƌ#0  '$P09' !  $!0@( nB$B!Rn!$"$ n!$"! ( 0'<<'!'+!$ !@$$!`n%n$#d+Q$<`#0+:@!+6@+5@!+@!   P ($09' nB$B# Q+n!$@$$nc$c+d@$n!$#!` n!$"!$('<4;'!'+ ($!@!!!!  $!,b!($ !+" @ $b&&+"@p$ƌ!( !,9' $ B!(! !( ,z9' !@!(( !0'<:'!' ,($  '<9'!'!`p$ P0l $؊ ! @!($`p!$"( ,nB$B $$ @!0@`p$ `p$$ `pc$c !bp$\p!$"('<|8'!$p!$"\p!$  nB$B7G!(n$!0$ n!$'0t9' n$,$9' 09' n$n$!00t9'  '< '!'!n$, #$ 40Ԋ n$$ n$!(,'! P n$ #$l  ('< '!'$!(n$($',P  '<'!'!('09'  @+$'09'  '<('!' n$n$0(,,_9'  n$n$$!@,_9'  @!@@!P!PC` @!!d$n$ X+$ppB$B @tpB$B $$@ L%$ nB$B `+$@ $$ l+$09'  0(8'",nB$BC(B$,n!$" `! `0|9' n$$0hqB$BC?$8b$$4$,nB$BC(B$,n!$" `! `0|9' hq$ +$_/$ b?$nB$B$B$0?$bnB$B$B$0hq$0$!0$,i9'  @4 $$n!$0"nB$B$0nB$BB$0hq$0$!0$,i9'  +$ @4n!$" +$ ,$ '$09' n$ 0,$ $n$ 0,$$$,i9' @4! @,]9' g0$b,nB$B@,nc$c!C@!SB$,n!$" 4,$0h9' ! @0,69' n$n$,_9' !@09' !0@0'4',o9' 40$!8,{9' 0,h\9' 40,\9' 0!(@4,_9' L@!@<$4b>$0 $ b $!(,z9' .,bnB$B%@!0!(,z9' 0C $b&nB$B*@  b $0,@k9' 0R&,]9' @0! ,_9' n!$",0e9' ,a9' n$ $b$,nB$BC(B$,n!$" `B$! `0|9' B$b$$W$bnB$Bc!PB@!CB B0$@W$n$$!0$,u9' ! @$!0$n!$",u9' n!$"W$b!0n$$$nB$Bn&D$+ @! $ b&+@ $b $ b! ! ,h\9' #@! &!(!0$n!$0,{9' n!$"C$_bD$<b)nB$B,n$B$n!$",_9' n!$"nB$Bnc$cD$,nB$Bn!$#*@,n!$$,nB$BC(B$,n!$"`+$0|9' ,,a9' ,0e9'  8,$$,nB$BC(B$,n!$" `! `0|9' ,a9' nB$Bn$B$+@$ $n!$ #,e9' nB$BD09' @,T^9' nc$cn!$"d$,nc$c*`,n!$$,nB$BC(B$,n!$"2`-$0|9' )nB$BB$!Cnc$cCn!$#M@!n$1&,]9' n!$"nB$BB$!CC*"@.n$,h\9' 0C $#b,Hc9' ,a9' n$ $,@k9' n!$",,a9' n$ $,@k9' n!$",Hc9'  H,$$n!$"09' ,nB$BC(B$,n!$" `X$! `0|9' X$e!$n$!C $bs$ e!0$n!$"n$!($,{9' n!$"s$bv09' !@Z$ 049' s nB$B0@ppB$B)@tpB$B"@n$ƌn$n$$0|9' !@nc$cnB$B#C="n!$8 ,,a9' ,0e9' ',nB$BC(B$,n!$" `b$! `0|9' b$b$$nB$B! PnB$B+@nB$BB$+D@n!$$c@!CB B0@eb:+$#(!0$,u9' n!$"n$c@!CCb0@!0_$ $$,u9' _b0@!0$$y$b$Y$b!Y$ by$09' !@0'4'!0,o9' $!($ '$,  @c$)bnR&R +Q @# $b"&44$09' @  X,$!(, @!(04!8!0,{9' n!$"W$ d,$, C@!804$,{9' ! @n!$"c$bd$ $,@k9' nc$cn!$"c$&C,Hc9' $b,,a9' ,0e9'  $$$049' $c$b t,B$B t,B$B$ t,B$B&d$by$ |,B$B |,B$B$ |,B$B&y$bY$ b ,B$B ,B$B$pB$B!xp!$!""! @0$ 0!b+C!(@ `40 $b$1&+`0pB$Bxp$! $ !@09' !0 !8 ,$ '09' ],nB$BC(B$,n!$" `! `0|9' ,Hc9' n$nB$B!(09' n$!@ $%b$ n!$"09' ;$^o!$"0|9' nB$B^oc$cB C,d`9' ^o!$ ,nB$BC(B$,n!$" `! `0|9' n$c@!CCb0@_$b0$$$@$$$,u9' n!$"nB$Bnc$cB$+b@b$n!$"n$c@!CB B0@$$$09' !@.$ !nB$BB$!CC-$nB$BQ$n$,h\9' n!$"! $,c9' m,n$$n$,a9' n!$V",nB$BC(B$,n!$" `! `0|9' n$@ B!Cb0@B !b0@B!B$ n!$",`9' ,D~9'  ,,a9' n$nB$B $,@k9' nB$Bn!$"n$nB$B , f9' n!$"! `0(9' c@!CBB0@,n!$ n$,h\9' n$# $b nB$B@$n!$"PHD@<8X'<@ۜ'!'(!! $40, !$ R@ /B$B /1&L@P0A! .@$$  .! @ #$l $.$ .@$! @! @ /$l $@&?$P0! @'l  `! @ #$l # $ b! @ /$l 1&"4,($ 8'@1&d!(| 1@s&s&B @! @ 5$$X @R& 5B$B!(@ 5B$B'$' d!( !0@0P%9' b@b@'!0$ 5$09' '$!0 Q@ $!  TLHD@<8X'<Ј'!' 5$$09' 0(9' $0(9'  '<8'!'((,$40 ! @! 5$| y@$ $C$ 0t$p $0<"$p $0<"$p $0,$$p $0@#$p $0,%$p $0x$$p 0x$$$p ! 0P9' 0P 9' ! $ $ X$$D @! 0 9' !  5$8  xB$Bx& @& @셆ƌ$ 5$09' 08(9' 2@$ 6$| @$ 6$|  @$ 6$| @臅$ X5$0P%9'  !( 0(9' !(  6$! `0`9' $0(9' $0(9' $0(9' $0-$p $0(9' $0(9' $h '! @ԅ @!@4&$&$ 6$ Q!8 09' $$'$ @!@$ 4,($ 8'<'!' `6$'$ Ԁ @$ ! @h $ $('< '!'!($  '<Ѐ'!'48 <,($c$c@E0B0*0C$!C$,$4''Q&4B$B!( @!0` ! @ $X$T !@!( !0` @! @< !  BA$ ,$ 0'<|'!' 6B$" ' 6$$'('0HD@<84 Ԁ !@B0 @2( !$"2 @ 2 b@ 24!$# @$b@!$#$8  @$$ 6$ $p 2@$!(h  A 6$ 0=9' $Ƅ 6$059' 0H9' ! Ѓ !@<$<$! Ѓ S`  # d$h ! Ѓ !@& #2<$0H9' 0|G9' &@! ;$|  @!@! @$ B,@!8 (;&!8 '$ 0;$䉙 臄 8;$$!( 'Ј  <;$Ĉ !  A ;$   4,(8'<W'!', !($@ !@ D;$ @$!(@ L;$ E  h;$$ 臅 p;$$$ !   8  A!(@ x;$ ( 0'$l ( 0'<P'!'4B$B  @!$ 4!$"4c$c$ 20 >$02  ?$ hb #j!C()#(!&%$\$!(@&yb,z@ ?!$!""!\@%$! @!( 4?$0e9' & <& $!(@ ! @  @ >$l D<840,($ H'<8F'!'L$$!!!(! @,( L  !@$ A$ dA$l "@$!(  % pA$  B$B8+# p $$!@p ! !(`!@0d9'  A$@!(@ !(@$p !( $p ,$ 0'<4D'!x'$|x ;1& $-$b$ `p$ ;1&$b&v$ ;1&b-$b$@!  '0p9' 䂄!( !0'0g9' 䂄ć $0b0@! @0" '!<4>'!' !$ !(@@! ! C<$$'0@&& $  !('<='!'<40,($ @8P!T! !!X!@ ,y@("!"!/!(!b b@XC!CP! @b@!(b8C!CB(E! @0@|9' !@! @!(0}9' !@$$!8! @!00`v9' !@$ b.`$ b$ b)1& hG$  |G$ G$&`g0!8 G$   0 G$  1&+>@&*e@DB@! @ @ V$` $$0b0 U$  U$@ V$`  V$  ,W$ 0'!( l\$$$@$$ \B$!EB` B0@'!$! !($( 8$'6! @$!0( 8'@6!0$! ( 8샙 8!8@!(@'!0  L]$ 8 @' `]$ t]$ 8T''<'!'$ ,($! @4 ]$|  ]$ @| @#$b&@4!  ]$'Ԁ !@B0 @ ]$| 5@􅂏B4!bb@42@$! 2  ! d  ]$4'89' @! @4@ 8l9' ,$ !0'<'!'40,( <8$!$ f#8C!*!!@@!@!0!F+Q;@$d0 $&/& $b+*`(@+%&&+Q$@$b$b&+Q@<%bd%bgt4'  &&+@c b# #0!d#Dc#  b!(@ <40,($ @'<쐜'!'$! ]$$ T !@! @$􃙏 !  !  !(@! Ԋ !$('<'!$!C$CB$FE$,c$B$,$<̏'!x'p!p$xt| !@P'#&0B$! @#"0   , ( $ 8%9'  A!@$ ]$ !4@!8!B$+ @=$ b$l !"B0B0%C!"B$$$`<H0$%!"B$?b0$`!"B@$d!h''!'$ !!!0 f$!8!  f$ ! ć ! $!0   f$ @!  f$  @@c@!CBB0@!  $b$!  $(' FE4c$c*t@4ԅB$B@$  ! `!b$  $#(!  g$䉙  @'D4؅B$BFDAF  Ĝ! F$F<ųB40 F$FDDDD4!8D FDDBç!R#T ! `$  ! `!b$  $#(! !8  g$䉙  <$  ! `!b$  $#(!  g$䉙  <ųB4B@'! !R#T#Q@!Q#B$  ! !$  <4'$#(!  g$8!8C9#8#G#"䉙  @'! $  !0@!($  $ $H'8yB$D  @'$!0<@  $8$z9'  ! 8$z9'  䂅 $4؅!$  '<`2'!'($0, !B*@!0 g$! | @-$bC! &!  g$ 1@! 1&0hR&!  g$| C@$!  h$| 8@ $!  h$| -@$!  h$  ,h$| @! $ 0h$| @!   $ 4h$| @$T"R&!  8h$  @BB$"R& B*m@1&B Dhc$ @R&1& Hhc$q0($ #8'

(-B$!CBc$!8 v$! 䉙 ! (' `xB$9 hxB$4 txB$/ |xB$* xB$% xB$  xB$ xB$ xB$ xB$ !8 x$! 䉙 ! ('<ܑ'!' !$,(! `x$! | @$!  x$| @ $!  hx$ }@$!  x$| @! p$ tx$ f@$!  |x$ [@$!  x$ P@$!  x$ E@$!  x$ :@$!  x$ /@ $!  Xx$ $@$!  x$| @ $! '!0, !@ @PB@$b,@$#!,$ 0'< '!'($! ! !0/$,, !@!( ! @@@@Q$Ć @$/$BB/$"!( @'Ć @$B! %CB0($ !8'<'!'$ ,(!$!! @' !@ @$PB@#!8,$ !0'"$!(@!0` $ 4@$$!$.$ $("$$$B! @F@!8$B0 B,!(g @!C@!FB$ $.$b($$@$!,$ !`0'<'!',(!!$!($4!0 ( ! @ y$|  @!! @ y$| @! @!3 6 /$, @!@@!(@!0`! 4 @!@#$b $b$ $"&'!0L @"+C@$"/$!@4,($ 8' FEDDDD4!8D FDDb,$F<DDDD4!8D FDD%bb,6@b,b,d@$jb,@b,_b,^@d$5b, @:b,0b,X@2$b$B,S@ $RP@d$?b,M@<$Bb,I@@$H @b,b,C@$b$ B,>@$=;@d$b,8@$b$ B,3@,$2@ b,b,-@$]b, @b,Sb,'@X$b$ B,"@$!@d$b,@$b$B,@ $ @Gb,b,@$"b$B, @$  @d$Qb,@L$db$)B,@$d$ǬǠǤ4!$"''!' !<$}9' C ! ``! bB0@! ` !('<='!'$$,( !4R&&$P ! <|9' ! 1&R&E !$Q> !`$&=$, %@! <$}9' P!8 @$@ȅ$ ! 䂄 $<|9'  R&@B$!(@<t9' R&Q $&!`,$ 0'<8<'!'  a$ <Tw9' D!@Ѕ$D }9' @!@4$/@!<v9' @$@ԅ$@4B$B䂄G$ 4B$BCB$4!$"`! @! ('<:'!'$ !C4B0@! 0l $l ! l !$('< :'!' !DHa9' @܅$!0@H`9'  ('<9'!' ($!!@!c$! b@c$@! x.$q$! D_9' !(@".$!@@1& !D]9' !@ $e$b!D]9' @x.$B$# DDLW9' !@! D؋9' 4B$B$('<*'!'(!'0,DXY9' ! D9' ! D$9' 'DY9' 4 B$B@! H9' 4ܘc$! @C!(D9' 'DY9' 0(8'<)'!'$ ,(!!!. @@(!$!""!\@$$D$9' 4B$BP,DL9' $$H9' @!@$E2D$9' 4&! H9' zDc$4XB$BA@! B2?@!(@=$D$c$7! Dc$2! D\c$-! DXc$Dc$#! &B($%(E0D$9' 4B$BB,@P4 B$B9@1D$c$! !(@!` -$D$9' 4 B$B@4B$B@ "@!@ !D9' !4!$04B$B @B2H9' B2 @$4B$B$b@D9' ,$ 0'<%'!'44B$B B$($44!$"!!0$$D$9' 4 B$B+@!(4 c$c$b$4$B$BB$4$!$"@$4 !$ 1b4$B$BB$4$!$&@"4 !$! # $4$b,$D$9' 4 B$B4R&R@44B$B4!$2( B$44!$"0'<#'!'< '8!! `40D@!DXY9' P'! '#$D9' 4 B$Bf@! `! 4!$ @44B$BB$44!$"E12 D!0H9' D!( D$9' 4 c$c&`$b$4$B$BB$4$!$"@$4 !$ b4$B$BB$4$!$ @"4 !$ 44B$BB$44!$"! `DY9' D<840H'< !'!'8 '0!! @D<4!@DXY9' '!(@$D9' 4!$ 9 ! @4 B$B2@0"! ED$9' @4 B$B@!(` $D$9' ! @1 ! @4 B$B@! @DY9' D<840H'2!(32! !@$ b4lB$B@$4B$Bx.c$c! =$#C,  P$! !( !0DH9'  !@b&C,"2! !(!0@!8`R&$b$'bMA66! D9'  $`<AD`9'  $! @$#D9'  ! A $4XB$ B @ $! !(!0!8D9'  b$A! @! D9'  b_x.B$B4$! #(!0D9'  L$J@$4c$c.B$B bD]9'  !@`x.B$Bc$#b(! !(!0!8`4!$#D`9'  @! x.B$B4c$c!T#bB$#b4!$#D9'  $(b!$|b$D,$b&&$@4B$BB4!$"b$$B0C&$b$!XTLHD@<840`'<8ʜ'!'4&@$!!! @!(,(40 !!Dl^9' !@1&$"r1&@s&! @!(<hr9' !@ $b$b$&&$"4!$04,($ 8'<ɜ'!'( !!$!$ !(@! !0 !8@D9' ( 0'(@'$\$CEĠA&1@$b&@$B88&bB02@!8`C80!@(@}$@$&@$!@$$8"$11.$!(`:$$}$@8'\$Ġ $$Ġ$$~&0@"$ $( 4!$&0'$<$l @"* @hb@B$ B,@$D 9' $#&$bx.$l! |.$4!$"dx.!$$h#(4!$"$|.!$%4!$$$U@$ D9' !@` $ D9' !@ $4'!`O$D9' !@~$b $ 3! #b1&R&@ !`@'C`D$ C$`$C $b@'p,B$BB$p,!$"4B$B4!$"~$'!(D 9' $s>$DLW9' !@$"DL9' R!@T$|$Q$&$L$L$@DL9' !@<$ =*@&$7:$5$7"$DLW9' !@$$" DLW9' Q4!$"DL9' !@-$$4B$B C4B$B @$$ ""D 9' `$b&"4!$1$4!$"!`'DL9' !@B(@($&{$$_$"2c@!CBB0@($& b,@< B4bB0@($h$$$hD 9' =($$DL9' PD 9'  hbhx.c$c$$#{$$$hDL9' !@#$DL9' !@}$#$ $!*<@&_$ 2c@!CBB0/@&h.B$B bD]9' !@pc$hDL9' !@B(Q@_$2c@!CBB0@C B,$@&h.B$B bD]9' !@pc$hDL9' !@B$ B,@ b,@< B4bB0@hPDL9' h!@c$h@$Vh.B$B b=$D]9' !@=$bc$h6@!%$#&*@:$#$ !  DL9' !@$@l1&!(! , @!@$#Q!b#$!$$DL9' QR&D 9' px@s6x.c$c%S!tb$Btpc$tx@c$ 4$p' @h@hl `$! @4!$ 4l!$"芙 4tB$BB$4t!$"x.B$Bhh#b@! @DV9' hhx.$!0@舙 4lB$B`p'4l!$"<p9' x.1&14B$B @$Hd9' 4!$ DL9'  $!@cS!@ B(@&IB,\$`$kDL9' S!@p,B$BB$p,!$"4B$B@$Hd9' T`$$$*p@"$*.B$B "! D]9' !@tq$*'@@$p,B$B4!$"H9' p,B$BB$p,!$"4B$B4!$".B$B "! D]9' !@q$[p.B$B "! D]9' !@`x.B$Bq$# "DLW9' ! @D9' d@d'@$DLW9' 4!$# `@4䘄$4!$ $H9' !@@4!$#H9'  $C $H$9'  QD9' 4ܘ!$ |.B$B+B@D[9' |.B$B+B@x.c$ch$@hh! `!0@舙 4tB$BhB$! h4t!$"hl h<p9' `x4!$#4l!$"$p@$$h bhxC$$bxh$bc$hp$`"$ $h$h<'!' `$$b$! `b!( &<hr9'  $C! `&$ !('A :$H 9' 14hB$B@P$DD9' !0@@h$!( 4hB$B@$DD9' !0@!( @$D9' H@<8P'<8'!'4@ @@"2 @! `=$ B$! @!@ B0@l $$C%"@$DV9' !@B P"2 @! `DV9' !@,$ 0'<֜'!'$ !!4tB$BB$4t!$"!( H9' <p9' $('<8֜'!' !H9' ! @!(Ht9' C `! b B0@=$d D$ !('<՜'!'4&$ !!( H9'  @=$  B$! H9' $('<Ԝ'!'x.c$c($ 0,!!%41&0$RS.B$B bD]9' !@bc$1&4B$+"@.B$B bD]9' !@`x.$c$# dDLW9' 0($ 8'<Ӝ'!'!4!(! '! @<0,8(H 9'  ! @#(($H$$!@ b@!`@R& +".@$=$ !@B4 c$ @&! DHa9' !@"@4$!(`!0@#8H`9'  1&+"@<40,(!@'<ќ'!'$,( $B@@$rB8+!#bD }9' B$>@4R&RP5! =$, !@@! Q$H9' ! @!(Ht9' C`! b%S b!( !0`H9' R&P!  $!(`!0H9' ,$ !0'<Ϝ'!'4& & @! @HP9' &@! @ !('-$c$fc$p$b@$p$ !8@ɄB$fc$$!8!<'!'t,B$B$ Q4!$14XB$B @t,B$BB@!( t,B$B!( D$ (!@.B$B4ԟ$B$ԉ" @!@4B$B@ $" $p ;$9A!!6!t,B$BB-@!4hB$BC $#b!0! $ @!0@B0@$$0! $ @!@$<s9' !$('<@'!'( !!4TR&R$4T!$ D9' H9' $4L!$ >"$BB08@$6@@ !@ P! !(d  $.$!(DD9' $H9' $H9' 42"$H`9' $H`9' @! @Ԕ$!(T @@$@Ԕ$D9'  @4XB$B@$H9' $H9' $H9' 4& ! D()9' ! ( 4!$ 0'<䪜'!'$ ,(!!!!4B$B! @!(D49' @4B$BB$4!$H"$$BB0@$@!( E! @d $ ! $4D!$2Dl9' ! $ %@!D!$$$4 B$4LB$B @ `! `D@89' ,$ 0'<'!' !'$,(  A!@$D9' $b! D$ !@!0@B, @! Eȃ b!($D29' W@ $$p $$p $$p $$p  $!(p $ b!0 !(!0.!$0D9' x.$4$ƌ! #0ȃ !  ,$ 0'$! !:$, @1&D$@:$ ؊ B!  C! b$:$, ! @#(P@B$B!E@ @#0B1&!bB!Fb! ( 0'<@'!'( !$$ @B$! @؊ %!@.!.@x$, @!P\$b&#!P1&C%.&!P@(!@ 0'$#"<$" s&B>$"!!t$'#0!!(!0 @&舙 !(!0  @'舙 $s&'!CB@!R@'!!`$Fb! q&!vB @!dC`$"b#1&!dB@/ s&s&$'#!%&!0 @1&舙 !( !0 @'舙 #!@&! E&!0@1&舙  @E&! !0舙 s&&&&s&@&!!!+@'(!C($b{$b&R&$'#3! !&!0  @&舙 !(!0  @'舙 $s&'!CB@( @9@!@5'!$C)$b}$@!$}$b!$C)$bR&&$#!$%&!0 @1&舙 !( !0 @'舙 $s&! @B@@'! @'!( $b$@s&`$#3!!(!0 @&舙  @'!(!0 舙 !' ' @$@! !C'!( $$!@!0b!8<$b>$b $ b c$Àb$d$b$@!!0 '!c$b@s&s&'`#@Q$!R $ Bs&<$B>$B|$B&$B!&!0  @&舙 !(!0  @'舙 a1&'$b!"$ bs&!C'$b"$bs&s&'!bb$$ E/$s&b$0E~$@b! @!@f$Č$!CŌ!C$R&!@ ! @#"X 4!h¯!!$b!(1&!('!Q $ b! ` $&1&*2@'! $b1&&1&! @܊ *3@& $ B $܊ @ 4,($ !8'<`4'!'@$$ ؀ !@ C `! ! @#$b< ! l !  !@@! @!  $('b! ȇ ! @!(@!@T  A! !(@@$ԃ q$l 2@!(@48! @  A!(@@Ц$ԃ !(@'x N!,@$B0C'!(@x 2@@!P8'8X! @<L  A!(@@$ԃ 48! @| A$,$b@Ц$!(@,ԃ ,! @,  A!!(@@$ԃ !pld`\XTPLH!`x'<0'!'($ 0,!!! !@!@ $#2C,`!0@$!0@! ' @!@'`! `'!0@ȃ P @ @P$ !@@h$ԃ !@ !P+Q@!@0($ 8'<'!' !L9' !@!` '@! -! `E| -@! E| %@'Dd @'<P!q! `Dd @! `P! qP !@@! ! ` ! @!'<Ӝ'!'(!$ 0,$؊ !@!X e& @! Ą !b!@R&b! !@,D$!(@$+!qc$C0! ($ 8'<Ҝ'!'@$'DLH@<8d @$@!`$B0C@$̃ !7@!@@$ԃ A F.$ !(`bFb!@T ! @'!@d  @! `,`$B0C<P!ql !! @ @$@ C$! @  `!`@$ !@!`LD@<8P'<М'!'$ ,(!!!!!( !0! ` #!"@!@@!B!@,$ !`0'<Ϝ'!'$ ,(!!!!!( !0! `d #!B!"@!@!( !@,$ !`0'<@Ϝ'!!(@$/$b$+@!(!0$@/$b!0!<Μ'!',($ !!!!!40 `!2Ps&!(`Ą !@!2P $R&!  R&!  !@b&*R$!  !  @! l !!2@! 4,($ 8'<͜'!'!(L9'  '<4͜'!'$L9'  '<̜'!'$ $!' ,!(, !(@b@! !  !(@,$ !0'<@̜'!'$!@< ht4!',( @$P$B,@$B,@P$ ",$ 0'<`˜'!'PLH!h!P0 !E'"00%d%b.J%%e!0B-@ì $H'&C&D&CJ%@%CPC-`$ !@!H!!!`!P!(!@@&$#&@&%D!C!KJ%!C!X !0D-? Z%e%GTX! L`9' !('!PBc0! %$b,`$('<Ŝ'!Eg<<<2<#B4c4ܥ4vT4  $ @ૄ$Ĉ +@!(Ą ! 4' @ R&P@@!! L 9'  1&*"@ &!l !`4,($ 8'<ت'!c@!CB B0 @$@!CB B0@>@>c@!CB B03@$:$*$b!0!(`c@!CB!8B0@! $c@!CBB0@$:$b!(! ! @$!`f!(`@! !!`<`'!'HP $d`!!T!(!p$! l\Xh( H\3$!(! !8@&H&p&l&T&P&8&(&D&L&0&&\&|&X& $(,048<@D H* @!!048<XPTld`\XTPp'<'!@'4B$B!@!$4!$"@\$@l$< @!@@p$@\$ԃ L0 9' x!@'$!0@' ! $!0@ ! @$  @$! @$ +(!L 9' ! `!@L 9' !(@! !0!@L` 9' $!(`! "|  @'$!0@ ''@! `! @ @! @@\$Ĉ $4!$ ! @ !!`'<'!'! L9' @L0 9'  '<'!'4,B$B ($! @!L9' @$4,&!! !( !@ @!@! !( !`0'<'!'<$8!( !'HD@Ԋ T3$4' P@$('!( Ԋ T3$'4'  A&!( $(  -*1.('!( Ԋ T3$4' A('!( Ԋ T3$!4' A ( '!( Ԋ T3$p4'  A(&!($(  ',04(,(04'!( Ԋ T3$p4'  A(&!($(  ',04(,(04'!( Ԋ T3$B4' @$($$L9' @!@'!( Ԋ ! @$4'( i@8&,04($<@D!( '8Ԋ ! @4'  AH&!($(  !( ,04(LHPT!( 'Ԋ ! @4'  A!(X&$(  !( ,04(\X`d!( 'Ԋ ! @4'  @h&,04(thlp!($( !H@<8!`P'<ܝ'!' !L9' A! C$@$b! ` !0@&@Ĭ$ $ !`('<'!'(8044&! @ $@$ 䉙 (!80@'!@<Y':'8'6''$H -', !8@'@$ $', !8@'$@$t  '$ !`\! $ ! $ !@$b $!  \ć '<슜'!''@$d` \'$ \@p$$ \ć dh'< '!'$!! ,(40 !!ą ?$$ D!@!`ą 2@!`! `/$ b&&&/$b!``! `$ A C$ b! @&ą $!( @ą %!@! ą $ !(! `, @&@!( !!0`@$ԃ $4,($ 8'<'!B0@!$!""4@$4@!$"!0$!H!($$-$C@`@бB$!EB!H$(@$$$@("1E$C$$!(`@бB$!EB(@!H4@B$<'!'!! $! ! @$@!0 !E! Ԋ $('<0'!' !ā  @!(@$l B ('<'!' !@  @!(@ $l B ('<0'!'$ !@ @!@@@$ !(  D  @ @X$l B$(' (default /etc/sysctl.conf) sysctl [-n] [-e] -A [OPTION]... [program-text] [FILE ...] Options: -v var=val assign value 'val' to variable 'var' -F sep use 'sep' as field separator -f progname read program source from file 'progname'FILE [SUFFIX] Strips directory path and suffixes from FILE. If specified, also removes any trailing SUFFIX.[OPTION]... [FILE] Uncompress FILE (or standard input if FILE is '-' or omitted). Options: -c Write output to standard output -f ForceFILE Uncompress to stdout.[-u] [FILE]... Concatenates FILE(s) and prints them to stdout. Options: -u ignored since unbuffered i/o is always used[-R] MODE[,MODE]... FILE... Each MODE is one or more of the letters ugoa, one of the symbols +-= and one or more of the letters rwxst. Options: -R Changes files and directories recursively. Clear screen.[-l] [-s] FILE1 [FILE2] Compare files. Compares FILE1 vs stdin if FILE2 is not specified. Options: -l Write the byte numbers (decimal) and values (octal) for all differing bytes. -s quiet mode - do not print[OPTION]... SOURCE DEST Copies SOURCE to DEST, or multiple SOURCE(s) to DIRECTORY. -a Same as -dpR -d Preserves links -p Preserves file attributes if possible -f force (implied; ignored) - always set -i interactive, prompt before overwrite -R,-r Copies directories recursively-[dimtuv][F cpiofile] Extract or list files from a cpio archive Main operation mode: d make leading directories i extract m preserve mtime t list u unconditional overwrite F input from file-d[#] -c -f -b -d [#] -l [#] -S -L logfile -f -b -c dir -d num debug level -l num log level (8 - default) -S log to syslod (default) -L file log to file -f run in fordeground -b run in background (default) -c dir working dir[-c dir] {file|-}|[-u|-l|-e|-d user] file replace crontab from file - replace crontab from stdin -u user specify user -l [user] list crontab for user -e [user] edit crontab for user -d [user] delete crontab for user -c dir specify crontab directory[OPTION]... [FILE]... Prints selected fields from each input FILE to standard output. Options: -b LIST Output only bytes from LIST -c LIST Output only characters from LIST -d CHAR Use CHAR instead of tab as the field delimiter -s Output only the lines containing delimiter -f N Print only these fields -n Ignored[OPTION]... [MMDDhhmm[[CC]YY][.ss]] [+FORMAT] Displays the current time in the given FORMAT, or sets the system date. Options: -R Outputs RFC-822 compliant date string -d STRING Displays time described by STRING, not `now' -I[TIMESPEC] Outputs an ISO-8601 compliant date/time string. TIMESPEC=`date' (or missing) for date only, `hours', `minutes', or `seconds' for date and, time to the indicated precision. -s Sets time described by STRING -u Prints or sets Coordinated Universal Time[if=FILE] [of=FILE] [bs=N] [count=N] [skip=N] [seek=N] [conv=notrunc|noerror|sync] Copy a file, converting and formatting according to options if=FILE read from FILE instead of stdin of=FILE write to FILE instead of stdout bs=N read and write N bytes at a time count=N copy only N input blocks skip=N skip N input blocks seek=N skip N output blocks conv=notrunc don't truncate output file conv=noerror continue after read errors conv=sync pad blocks with zeros Numbers may be suffixed by c (x1), w (x2), b (x512), kD (x1000), k (x1024), MD (x1000000), M (x1048576), GD (x1000000000) or G (x1073741824).[-hmk] [FILESYSTEM ...] Print the filesystem space used and space available. Options: -h print sizes in human readable format (e.g., 1K 243M 2G ) -m print sizes in megabytes -k print sizes in kilobytes(default)FILENAME Strips non-directory suffix from FILENAME[-c] [-n LEVEL] [-s SIZE] Prints or controls the kernel ring buffer Options: -c Clears the ring buffer's contents after printing -n LEVEL Sets console logging level -s SIZE Use a buffer of size SIZE[-aHLdclsxhmk] [FILE]... Summarizes disk space used for each FILE and/or directory. Disk space is printed in units of 1024 bytes. Options: -a show sizes of files in addition to directories -H follow symbolic links that are FILE command line args -L follow all symbolic links encountered -d N limit output to directories (and files with -a) of depth < N -c output a grand total -l count sizes many times if hard linked -s display only a total for each argument -x skip directories on different filesystems -h print sizes in human readable format (e.g., 1K 243M 2G ) -m print sizes in megabytes -k print sizes in kilobytes(default)[-neE] [ARG ...] Prints the specified ARGs to stdout Options: -n suppress trailing newline -e interpret backslash-escaped characters (i.e., \t=tab) -E disable interpretation of backslash-escaped characters[-iu] [-] [name=value]... [command] Prints the current environment or runs a program after setting up the specified environment. Options: -, -i start with an empty environment -u remove variable from the environmentEXPRESSION Prints the value of EXPRESSION to standard output. EXPRESSION may be: ARG1 | ARG2 ARG1 if it is neither null nor 0, otherwise ARG2 ARG1 & ARG2 ARG1 if neither argument is null or 0, otherwise 0 ARG1 < ARG2 ARG1 is less than ARG2 ARG1 <= ARG2 ARG1 is less than or equal to ARG2 ARG1 = ARG2 ARG1 is equal to ARG2 ARG1 != ARG2 ARG1 is unequal to ARG2 ARG1 >= ARG2 ARG1 is greater than or equal to ARG2 ARG1 > ARG2 ARG1 is greater than ARG2 ARG1 + ARG2 arithmetic sum of ARG1 and ARG2 ARG1 - ARG2 arithmetic difference of ARG1 and ARG2 ARG1 * ARG2 arithmetic product of ARG1 and ARG2 ARG1 / ARG2 arithmetic quotient of ARG1 divided by ARG2 ARG1 % ARG2 arithmetic remainder of ARG1 divided by ARG2 STRING : REGEXP anchored pattern match of REGEXP in STRING match STRING REGEXP same as STRING : REGEXP substr STRING POS LENGTH substring of STRING, POS counted from 1 index STRING CHARS index in STRING where any CHARS is found, or 0 length STRING length of STRING quote TOKEN interpret TOKEN as a string, even if it is a keyword like `match' or an operator like `/' ( EXPRESSION ) value of EXPRESSION Beware that many operators need to be escaped or quoted for shells. Comparisons are arithmetic if both ARGs are numbers, else lexicographical. Pattern matches return the string matched between \( and \) or null; if \( and \) are not used, they return the number of characters matched or 0. Return an exit code of FALSE (1).[PATH...] [EXPRESSION] Search for files in a directory hierarchy. The default PATH is the current directory; default EXPRESSION is '-print' EXPRESSION may consist of: -follow Dereference symbolic links. -name PATTERN File name (leading directories removed) matches PATTERN. -print Print (default and assumed). -type X Filetype matches X (where X is one of: f,d,l,b,c,...) -perm PERMS Permissions match any of (+NNN); all of (-NNN); or exactly (NNN) -mtime TIME Modified time is greater than (+N); less than (-N); or exactly (N) days -newer FILE Modified time is more recent than FILE's -inum N File has inode number N Displays the amount of free and used system memory[options] remote-host remote-file local-file Store a local file on a remote machine via FTP. Options: -v, --verbose Verbose -u, --username Username to be used -p, --password Password to be used -P, --port Port number to be used[-ihHnqvs] PATTERN [FILEs...] Search for PATTERN in each FILE or standard input. Options: -H prefix output lines with filename where match was found -h suppress the prefixing filename on output -i ignore case distinctions -l list names of files that match -n print line number with output lines -q be quiet. Returns 0 if result was found, 1 otherwise -v select non-matching lines -s suppress file open/read error messages[OPTION]... FILE Uncompress FILE (or standard input if FILE is '-'). Options: -c Write output to standard output -t Test compressed file integrity[OPTION]... [FILE]... Compress FILE(s) with maximum compression. When FILE is '-' or unspecified, reads standard input. Implies -c. Options: -c Write output to standard output instead of FILE.gz -d decompress[OPTION]... [FILE]... Print first 10 lines of each FILE to standard output. With more than one FILE, precede each with a header giving the file name. With no FILE, or when FILE is -, read standard input. Options: -n NUM Print first NUM lines instead of first 10 -c NUM output the first NUM bytes -q never output headers giving file names -v always output headers giving file names[-[bcdefnosvx]] [OPTION] FILE The hexdump utility is a filter which displays the specified files, or the standard input, if no files are specified, in a user specified format -b One-byte octal display -c One-byte character display -d Two-byte decimal display -e FORMAT STRING -f FORMAT FILE -n LENGTH Interpret only length bytes of input -o Two-byte octal display -s OFFSET Skip offset byte -v display all input data -x Two-byte hexadecimal display Print out a unique 32-bit identifier for the machine.[OPTION] {hostname | -F FILE} Get or set the hostname or DNS domain name. If a hostname is given (or FILE with the -F parameter), the host name will be set. Options: -s Short -i Addresses for the hostname -d DNS domain name -f Fully qualified domain name -F FILE Use the contents of FILE to specify the hostname[OPTIONS]... [USERNAME] Print information for USERNAME or the current user Options: -g prints only the group ID -u prints only the user ID -n print a name instead of a number -r prints the real user ID instead of the effective ID[-a] [

] configure a network interface Options: [[-]broadcast [
]] [[-]pointopoint [
]] [netmask
] [dstaddr
] [metric ] [mtu ] [[-]trailers] [[-]arp] [[-]allmulti] [multicast] [[-]promisc] [txqueuelen ] [[-]dynamic] [up|down] ... Init is the parent of all processes.[OPTION]... MODULE [symbol=value]... Loads the specified kernel modules into the kernel. Options: -f Force module to load into the wrong kernel version. -k Make module autoclean-able. -v verbose output -L Lock to prevent simultaneous loads of a module -m Output load map to stdout -o NAME Set internal module name to NAME -x do not export externs[-cgmops] [sources] Copies files and set attributes Options: -c copy the file, default -g set group ownership -m set permission modes -o set ownership -p preserve date -s strip symbol tables[ OPTIONS ] { address | link | route | tunnel } { COMMAND | help } ip [ OPTIONS ] OBJECT { COMMAND | help } where OBJECT := { link | addr | route | tunnel } OPTIONS := { -f[amily] { inet | inet6 | link } | -o[neline] }[-signal] process-id [process-id ...] Send a signal (default is SIGTERM) to the specified process(es). Options: -l List all signal names and numbers.[-signal] process-name [process-name ...] Send a signal (default is SIGTERM) to the specified process(es). Options: -l List all signal names and numbers. [-c n] [-n] Kernel logger. Options: -c n Sets the default log level of console messages to n. -n Run as a foreground process.STRING Prints out the length of the specified STRING.[OPTION] TARGET... LINK_NAME|DIRECTORY Create a link named LINK_NAME or DIRECTORY to the specified TARGET You may use '--' to indicate that all following arguments are non-options. Options: -s make symbolic links instead of hard links -f remove existing destination files -n no dereference symlinks - treat like normal file[OPTION]... [MESSAGE] Write MESSAGE to the system log. If MESSAGE is omitted, log stdin. Options: -s Log to stderr as well as the system log. -t TAG Log using the specified tag (defaults to user name). -p PRIORITY Enter the message with the specified priority. This may be numerical or a ``facility.level'' pair. Print the name of the current user.[OPTION]... Shows the messages from syslogd (using circular buffer). Options: -f output data as the log grows[-1AacCdeFilnpLRrSsTtuvwxXhk] [filenames...] List directory contents Options: -1 list files in a single column -A do not list implied . and .. -a do not hide entries starting with . -C list entries by columns -c with -l: show ctime -d list directory entries instead of contents -e list both full date and full time -F append indicator (one of */=@|) to entries -i list the i-node for each file -l use a long listing format -n list numeric UIDs and GIDs instead of names -p append indicator (one of /=@|) to entries -L list entries pointed to by symbolic links -R list subdirectories recursively -r sort the listing in reverse order -S sort the listing by file size -s list the size of each file, in blocks -T NUM assume Tabstop every NUM columns -t with -l: show modification time -u with -l: show access time -v sort the listing by version -w NUM assume the terminal is NUM columns wide -x list entries by lines instead of by columns -X sort the listing by extension -h print sizes in human readable format (e.g., 1K 243M 2G ) List the currently loaded kernel modules.[OPTION] [FILEs...] or: md5sum [OPTION] -c [FILE] Print or check MD5 checksums. Options: With no FILE, or when FILE is -, read standard input. -c check MD5 sums against given list The following two options are useful only when verifying checksums: -s don't output anything, status code shows success -w warn about improperly formated MD5 checksum lines[OPTION] DIRECTORY... Create the DIRECTORY(ies) if they do not already exist Options: -m set permission mode (as in chmod), not rwxrwxrwx - umask -p no error if existing, make parent directories as needed[OPTIONS] name Creates a named pipe (identical to 'mknod name p') Options: -m create the pipe using the specified mode (default a=rw)[OPTIONS] NAME TYPE MAJOR MINOR Create a special file (block, character, or pipe). Options: -m create the special file using the specified mode (default a=rw) TYPEs include: b: Make a block (buffered) device. c or u: Make a character (un-buffered) device. p: Make a named pipe. MAJOR and MINOR are ignored for named pipes.[-q] TEMPLATE Creates a temporary file with its name based on TEMPLATE. TEMPLATE is any name with six `Xs' (i.e., /tmp/temp.XXXXXX).[FILE ...] More is a filter for viewing FILE one screenful at a time.[flags] DEVICE NODE [-o options,more-options] Mount a filesystem. Autodetection of filesystem type requires the /proc filesystem be already mounted. Flags: -a: Mount all filesystems in fstab. -o option: One of many filesystem options, listed below. -r: Mount the filesystem read-only. -t fs-type: Specify the filesystem type. -w: Mount for reading and writing (default). Options for use with the "-o" flag: async/sync: Writes are asynchronous / synchronous. atime/noatime: Enable / disable updates to inode access times. dev/nodev: Allow use of special device files / disallow them. exec/noexec: Allow use of executable files / disallow them. suid/nosuid: Allow set-user-id-root programs / disallow them. remount: Re-mount a mounted filesystem, changing its flags. ro/rw: Mount for read-only / read-write. bind: Use the linux 2.4.x "bind" feature. There are EVEN MORE flags that are specific to each filesystem. You'll have to see the written documentation for those filesystems.SOURCE DEST or: mv SOURCE... DIRECTORY Rename SOURCE to DEST, or move SOURCE(s) to DIRECTORY.[OPTIONS] [IP] [port] Netcat opens a pipe to IP:port Options: -l listen mode, for inbound connects -p PORT local port number -i SECS delay interval for lines sent -e PROG program to exec after connect (dangerous!)[-laenrtuwx] Netstat displays Linux networking information. Options: -l display listening server sockets -a display all sockets (default: connected) -e display other/more information -n don't resolve names -r display routing table -t tcp sockets -u udp sockets -w raw sockets -x unix sockets[HOST] [SERVER] Queries the nameserver for the IP address of the given HOST optionally using a specified DNS server[-aBbcDdeFfHhIiLlOovXx] [FILE] Write an unambiguous representation, octal bytes by default, of FILE to standard output. With no FILE, or when FILE is -, read standard input.[-p] [-p]process-name [process-name ...] Lists the PIDs of all processes with names that match the names on the command line[OPTION]... host Send ICMP ECHO_REQUEST packets to network hosts. Options: -c COUNT Send only COUNT pings. -s SIZE Send SIZE data bytes in packets (default=56). -q Quiet mode, only displays output at start and when finished.FORMAT [ARGUMENT...] Formats and prints ARGUMENT(s) according to FORMAT, Where FORMAT controls the output exactly as in C printf. Report process status This version of ps accepts no options. Print the full filename of the current working directory.[-sp] HOST Get and possibly set the system date and time from a remote HOST. Options: -s Set the system date and time (default). -p Print the date and time.pathname ... Returns the absolute pathnames of given argument. Reboot the system.priority pid [pid ...] Changes priority of running processes. Allowed priorities range from 20 (the process runs only when nothing else is running) to 0 (default priority) to -20 (almost nothing else ever gets to run). Resets the screen.[OPTION]... FILE... Remove (unlink) the FILE(s). You may use '--' to indicate that all following arguments are non-options. Options: -i always prompt before removing each destination -f remove existing destinations, never prompt -r or -R remove the contents of directories recursively[OPTION]... DIRECTORY... Remove the DIRECTORY(ies), if they are empty.[OPTION]... [MODULE]... Unloads the specified kernel modules from the kernel. Options: -a Remove all unused modules (recursively)[{add|del|delete}] Edit the kernel's routing tables. Options: -n Dont resolve names. -e Display other/more information. -A inet Select address family.[-t] [-a ARG] [-u MASK] DIRECTORY Run a bunch of scripts in a directory. Options: -t Prints what would be run, but does not actually run anything. -a ARG Pass ARG as an argument for every program invoked. -u MASK Set the umask to MASK before executing every program.[-efinr] pattern [files...] Options: -e script add the script to the commands to be executed -f scriptfile add script-file contents to the commands to be executed -i edit files in-place -n suppress automatic printing of pattern space -r use extended regular expression syntax If no -e or -f is given, the first non-option argument is taken as the sed script to interpret. All remaining arguments are names of input files; if no input files are specified, then the standard input is read. Source files will not be modified unless -i option is given.[OPTION] [FILEs...] or: sha1sum [OPTION] -c [FILE] Print or check SHA1 checksums. Options: With no FILE, or when FILE is -, read standard input. -c check SHA1 sums against given list The following two options are useful only when verifying checksums: -s don't output anything, status code shows success -w warn about improperly formated SHA1 checksum lines[N]... Pause for a time equal to the total of the args given, where each arg can have an optional suffix of (s)econds, (m)inutes, (h)ours, or (d)ays.[-n] [FILE]... Sorts lines of text in the specified files Options: -n sort numerics[-afo] [-n length] [file ... ] Display printable strings in a binary file. Options: -f Precede each string with the name of the file where it was found. -n N Specifies that at least N characters forms a sequence (default 4) -o Each string is preceded by its decimal offset in the file.[-a|g] [-F DEVICE] [SETTING]... Without arguments, prints baud rate, line discipline, and deviations from stty sane. Options: -F DEVICE open device instead of stdin -a print all current settings in human-readable form -g print in stty-readable form [SETTING] see manpage[OPTIONS]... [VALUE]... [OPTION]... Linux system and kernel logging utility. Note that this version of syslogd ignores /etc/syslog.conf. Options: -m MIN Minutes between MARK lines (default=20, 0=off) -n Run as a foreground process -O FILE Use an alternate log file (default=/var/log/messages) -R HOST[:PORT] Log to IP or hostname on PORT (default PORT=514/UDP) -L Log locally and via network logging (default is network only) -C [size(KiB)] Log to a circular buffer (read the buffer using logread)[OPTION]... [FILE]... Print last 10 lines of each FILE to standard output. With more than one FILE, precede each with a header giving the file name. With no FILE, or when FILE is -, read standard input. Options: -c N[kbm] output the last N bytes -n N[kbm] print last N lines instead of last 10 -f output data as the file grows -q never output headers giving file names -s SEC wait SEC seconds between reads with -f -v always output headers giving file names If the first character of N (bytes or lines) is a '+', output begins with the Nth item from the start of each file, otherwise, print the last N items in the file. N bytes may be suffixed by k (x1024), b (x512), or m (1024^2).-[czjZxtvO] [-f TARFILE] [-C DIR] [FILE(s)] ... Create, extract, or list files from a tar file. Options: c create x extract t list Archive format selection: z Filter the archive through gzip j Filter the archive through bzip2 Z Filter the archive through compress File selection: f name of TARFILE or "-" for stdin O extract to stdout C change to directory DIR before operation v verbosely list files processed[OPTION]... [FILE]... Copy standard input to each FILE, and also to standard output. Options: -a append to the given FILEs, do not overwrite -i ignore interrupt signals (SIGINT)[OPTION] Telnetd listens for incoming TELNET connections on PORT. Options: -p PORT listen for connections on PORT (default 23) -l LOGIN exec LOGIN on connect (default /bin/sh)EXPRESSION or [ EXPRESSION ] Checks file types and compares values returning an exit code determined by the value of EXPRESSION.[OPTION]... HOST [PORT] Transfers a file from/to a tftp server using "octet" mode. Options: -l FILE Local FILE. -r FILE Remote FILE. -g Get file. -p Put file. -b SIZE Transfer blocks of SIZE octets.[OPTION]... COMMAND [ARGS...] Runs the program COMMAND with arguments ARGS. When COMMAND finishes, COMMAND's resource usage information is displayed Options: -v Displays verbose resource usage information.[-d ] top provides an view of processor activity in real time. This utility reads the status for all processes in /proc each and shows the status for however many processes will fit on the screen. This utility will not show processes that are started after program startup, but it will show the EXIT status for and PIDs that exit while it is running.[-c] FILE [FILE ...] Update the last-modified date on the given FILE[s]. Options: -c Do not create any files[-cds] STRING1 [STRING2] Translate, squeeze, and/or delete characters from standard input, writing to standard output. Options: -c take complement of STRING1 -d delete input characters coded STRING1 -s squeeze multiple output characters of STRING2 into one character[-dnrv] [-m max_ttl] [-p port#] [-q nqueries] [-s src_addr] [-t tos] [-w wait] host [data size] trace the route ip packets follow going to "host" Options: -d set SO_DEBUG options to socket -n Print hop addresses numerically rather than symbolically -r Bypass the normal routing tables and send directly to a host -v Verbose output -m max_ttl Set the max time-to-live (max number of hops) -p port# Set the base UDP port number used in probes (default is 33434) -q nqueries Set the number of probes per ``ttl'' to nqueries (default is 3) -s src_addr Use the following IP address as the source address -t tos Set the type-of-service in probe packets to the following value (default 0) -w wait Set the time (in seconds) to wait for a response to a probe (default 3 sec.). Return an exit code of TRUE (0). Print the file name of the terminal connected to standard input. Options: -s print nothing, only return an exit status[flags] FILESYSTEM|DIRECTORY Unmount file systems Flags: -a Unmount all file systems -r Try to remount devices as read-only if mount is busy -f Force umount (i.e., unreachable NFS server)[OPTION]... Print certain system information. With no OPTION, same as -s. Options: -a print all information -m the machine (hardware) type -n print the machine's network node hostname -r print the operating system release -s print the operating system name -p print the host processor type -v print the operating system version[OPTION]... [INPUT [OUTPUT]] Discard all but one of successive identical lines from INPUT (or standard input), writing to OUTPUT (or standard output). Options: -c prefix lines by the number of occurrences -d only print duplicate lines -u only print unique lines -f N skip the first N fields -s N skip the first N chars (after any skipped fields) Display the time since the last boot.N Pause for N microseconds.[OPTION] [FILE]... edit FILE. Options: -R Read-only- do not write to the file.[OPTION]... [FILE]... Print line, word, and byte counts for each FILE, and a total line if more than one FILE is specified. With no FILE, read standard input. Options: -c print the byte counts -l print the newline counts -L print the length of the longest line -w print the word counts[-c|--continue] [-q|--quiet] [-O|--output-document file] [--header 'header: value'] [-Y|--proxy on/off] [-P DIR] url wget retrieves files via HTTP or FTP Options: -c continue retrieval of aborted transfers -q quiet mode - do not print -P Set directory prefix to DIR -O save to filename ('-' for stdout) -Y use proxy ('on' or 'off')[COMMAND ...] Locates a COMMAND.[COMMAND] [OPTIONS] [ARGS...] Executes COMMAND on every item given by standard input. Options: -p Prompt the user about whether to run each command -r Do not run command for empty readed lines -x Exit if the size is exceeded -0 Input filenames are terminated by a null character -t Print the command line on stderr before executing it.[OPTION]... [STRING]... Repeatedly outputs a line with all specified STRING(s), or 'y'.FILE Uncompress to stdout.[ashawkbasenamebunzip2busyboxbzcatcatchmodclearcmpcpcpiocrondcrontabcutdatedddfdirnamedmesgduechoegrepenvexprfalsefgrepfindfreeftpputgrepgunzipgzipheadhexdumphostidhostnameidifconfiginitinsmodinstallipkillkillallkillall5klogdlengthlnloggerlognamelogreadlslsmodmd5summkdirmkfifomknodmktempmoremountmvncnetstatnslookupodpatchpidofpingprintfpspwdrdaterealpathrebootreniceresetrmrmdirrmmodrouterun-partssedshsha1sumsleepsortstringssttysysctlsyslogdtailtarteetelnetdtesttftptimetoptouchtrtraceroutetruettyumountunameuniquptimeusleepviwcwgetwhichxargsyeszcatu%s Usage: %s %s %s No help available. --helpcfcompressed data not read from terminal. Use -f to force it..bz2Invalid extensionCouldn't remove %situvF:dmcftdzcat-Couldn't stat file %scompressed data not read from terminal. Use -f to force it./dev/null.gz.tgzInvalid extensionError inflatingInvalid magicCouldn't remove %s cf123456789dq.gz-%scompressed data not written to a terminal. Use -f to force compression.      %0*lo%s: socket ignored%s: file is the archive; skippingRemoving leading '/' from member names%s: Cannot openrInvalid magictxC:f:OpvkchjT:X:zZlistextractdirectoryfileto-stdoutsame-permissionsverbosekeep-oldcreatedereferencebzip2from-fileexclude-fromgzipcompress--%sc~tx:t~cx:x~ct:X*:T*Cowardly refusing to create an empty archiveCouldnt chdir to %sCreating bzip2 compressed archives is not currently supported.%s: Not found in archive ustar root/%s: Unknown file type%s Couldnt stat tar fileFailed to create gzip pipe/bin/gzip-fCould not exec gzip processFailed to vfork gzip processError exit delayed from previous errorsCouldnt wait ?Couldnt remove old fileCouldnt stat old file%s not created: newer or same age file existsCouldnt remove old file %sCouldnt create hard linkextract_archive: %sCannot create symlink from %s to '%s'Cannot create node %sUnrecognised file type%s %d/%d%10u %4u-%02u-%02u %02u:%02u:%02u %s -> %sSeek failureCan't create pipeFork failedData integrity error when decompressing.Compressed file ends unexpectedlyDecompression failedneed to fix this 07070Unsupported cpio format, use newc or crc%6c%8x%8x%8x%8x%8x%8lx%8lx%16c%8x%8x%8x%8cTRAILER!!!%d blocks %s not created: cannot resolve hardlinkerror resolving hardlink: did you create the archive with GNU cpio 2.0-2.2?Unknown compression method %d?? #+3;CScscc !1Aa  0@`      inflate_codes error 1inflate_codes error 2Incomplete literal treeincomplete distance treebad block type %d inflate error %dwritecrc errorIncorrect lengthustarInvalid tar magicInvalid tar header checksumpax is not tarIgnoring GNU extension type %cUnknown typeflag: 0x%xPz@|@|@|@|@|@|@|@|@|@|@|@|@|@|@|@|@|@|@|@|@|@|@|@|@|@|@|@|@|@|@|@|@|@|@|@|@|@|@|@|@|@|@|@|@|@|@|@Pz@Pz@\z@hz@tz@z@z@Pz@|@|@|@|@|@|@|@|@|@|@|@|@{@|@|@|@|@|@|@({@z@{@{@|@|@|@|@{@|@|@{@|@|@|@|@|@|@|@|@|@|@|@|@|@|@|@|@0z@|@|@|@|@|@|@|@|@|@|@|@|@|@|@|@|@0z@Invalid gzip magiccompressed with %d bits, can only handle %d bitsinsize:%d posbits:%d inbuf:%02X %02X %02X %02X %02X (%d)uncompress: corrupt inputShort readShort read, read %d of %du-invalid mode: %s%scmp: EOF on %s %s %s differ: char %d, line %d %.0s%.0s%d %3o %3o sl-pdRfiarb:c:f:d:sn-Help ntok is null for starting position! What do I do? invalid byte or field list,missing list of positionsb~bcf:c~bcf:f~bcfyou must specify a list of bytes, characters, or fieldsonly one type of list may be specifiedthe delimiter must be a single charactersuppressing non-delimited lines makes sense only when operating on fieldsa delimiter may be specified only when operating on fieldsr%2d%2d%2d%2d%d%d:%d:%d%d:%d%d.%d-%d:%d:%d%d.%d-%d:%d%d.%d.%d-%d:%d:%d%d.%d.%d-%d:%dd~ds:s~dsRs:ud:r:I::TZ=UTC0datehoursminutessecondsFile '%s' not found. cannot set date%Y-%m-%dT%H:%M:%SZ%Y-%m-%dT%H:%M:%S%z%Y-%m-%dT%H:%MZ%Y-%m-%dT%H:%M%z%Y-%m-%dT%HZ%Y-%m-%dT%H%z%Y-%m-%d%a %b %e %H:%M:%S %Z %Y%a, %d %b %Y %H:%M:%S GMT%a, %d %b %Y %H:%M:%S %z%f%Y.%m.%d-%H:%M:%S@l@D@@@cwbkDkMDMGDGbs=count=seek=skip=if=of=conv=notruncsyncnoerrorinvalid conversion `%s'%s%ld+%ld records in %ld+%ld records out 1k-blockshmkh-km:k-hm:m-hk Size1M-blocksFilesystem%11s%-15sUsed Available Use%% Mounted on r%s: can't find mount point.%srootfs/dev/root%-21s%9s %9s %9s %3ld%% %s %s %s %sPOSIXLY_CORRECTh-km:k-hm:m-hk:H-L:L-H:s-d:d-saHkLsxd:lchm.totalneEignore-environmentunsetu*+iu:putenv%stoo few argumentssyntax error%d 0%dnon-numeric argumentdivision by zerowarning: unportable BRE: `%s': using `^' as the first character of a basic regular expression is not portable; it is being ignored%s()quotelengthmatchindexsubstr:*/%+-<<====!=>=>&|n:c:qv ==> %s <== -%s%lx ugrn%ld uid=%ld(%s) gid=%ld(%s) directorypreserve-timestampsstripgroupmodeowner0755s~d:d~s-1cdpsg:m:o:coulnt create %scannot change ownership of %scannot change permissions of %sstrip failed%lu sfngetlogin%s|/@=%s: %7ld %4ld %-10s %-8.8s %-8.8s%-8d %-8d%4d, %3d %9s %9ld %24.24s %6.6s %5.5s %4.4s -> %1cCadil1gnsxAkcetuSXrvFpLRhT:w: @` 0@!`P` .%02x-%sscwthe -s option is meaningful only when verifying checksumsthe -w option is meaningful only when verifying checksumsonly one argument may be specified when using -cr Invalid format%s: OK %s: FAILED WARNING: %d of %d computed checksums did NOT matchCouldnt close file %s%s %s modeparentsm:pinvalid mode `%s'%spcub `%sinteractiveforcecannot overwrite %sdirectory with %sdirectoryfif-i:i-fmv: overwrite `%s'? unable to rename `%s'non-cannot remove `%s'16/1 "%3_u " "\n"8/2 " %06o " "\n"16/1 "%03o " "\n"16/1 "%3_c " "\n"8/2 " %05u " "\n"4/4 " %010u " "\n"2/8 " %21.14e " "\n"4/4 " %14.7e " "\n"4/4 " %08x " "\n"8/2 " %04x " "\n"4/4 " %11d " "\n"8/2 " %6d " "\n"4/4 " %011o " "\n"aBbcDdeFfHhIiLlOovXx  "%07.7_Ao ""%07.7_ao "" ""%07.7_ao " 8/2 "%06o " "\n"-+ #"\abcfnrtvP(AX(A`(A(A(Ax(A(A(A(A(A(A(A(A(A(A(A(A(A(A(A(A(A+At-A+At-At-At-At-At-At-At-At-At-At-At-At-At-At-At-At-A*At-At-At-At-At-At-At-At-At-At-A,A4*A+A+A+At-A4*At-At-At-At-At-A*At-At-At-A,At-A*At-At-A*A%sf-i:i-ffiRrcannot remove `.' or `..'p`%s'smhdnru-revenprawmintimeswtcheoleofparityoddpnleksanecbreakpass8litoutcookeddecctlqtabslcaseLCASEcrtdecparenbparoddcs5cs6cs7cs8hupclhupcstopbcreadclocalcrtsctsignbrkbrkintignparparmrkinpckistripinlcrigncricrnlixonixofftandemiuclcixanyimaxbelopostolcucocrnlonlcronocronlretofillofdelnl1nl0cr3cr2cr1cr0tab3tab2tab1tab0bs1bs0vt1vt0ff1ff0isigicanoniextenechoechoecrteraseechokechonlnoflshxcasetostopechoprtprteraseechoctlctlechoechokecrtkillUintrquiterasekilleol2startstopsusprprntweraselnextflushbkBonly one device may be specifiedagF:verbose and stty-readable output styles are mutually exclusivemodes may not be set when specifying an output style%s: couldn't reset non-blocking modeinvalid argument `%s'ispeedmissing argument to `%s'ospeedrowscolscolumnssizespeed%s%s: unable to perform all requested operations^-undef%s%s: no size information for this devicerows %d; columns %d;%d %d COLUMNS %s = %s;min = %d; time = %d; -%smin = %d; time = %d;%lu %lu ispeed %lu baud; ospeed %lu baud;%lu speed %lu baud;%lx:%lx:%lx:%lx:%x%lx:%lx:%lx:%lx%n:%x%nbkmreadfn:c:qs:v ==> %s <== %sno files\A]A]A\A]A]A]A]A]A]A]A\A]A]AD]A]AT]A]A]A]Aiawa-r-w-x-e-f-d-c-b-p-u-g-k-s-t-z-n-h-O-G-L-S=!=<>-eq-ne-ge-gt-le-lt-nt-ot-ef!-a-o()[]missing ]unknown operandhAhAhAXhAiA%s: %s%sargument expectedclosing paren expecteduAuAuAvAvAvAvA$sAHsAlsAsAsAtATtAtAtA@uAvAvAwAwA wA(wA0wA8wA@wAHwAwAhwAwAPwAXwA`wAwAwAwAtwAwA%s: out of range%s: bad numberc%sSTRING2 cannot be emptysnot a ttysnrvmpaAcannot get system nameunknownf:s:cdurw%7d %s lwcL %7u %s total%s %syc(K[?25hqdtestumaskargtu:a:PATH/bin/sbin/usr/bin/usr/sbin/usr/local/bin()/>>>|++--++--$===+=-=*=/=%=^=+-**=**/%^*!=>=<=><!~~&&||?:in,|+-!]{}; ifdoforbreakcontinuedeleteprintprintfnextnextfilereturnexitwhileelseclosesystemfflushatan2cosexpintlograndsinsqrtsrandgensubgsubindexlengthmatchsplitsprintfsubsubstrsystimestrftimetolowertouppergetlinefuncfunctionBEGINENDCONVFMTOFMTFS*OFSORSRS*RTFILENAMESUBSEPARGINDARGCARGVERRNOFNRNRNF*IGNORECASE*ENVIRON$*%.6g%.6g ?Internal errorUnexpected end of stringUnexpected tokenDivision by zeroInvalid format specifierToo few arguments for builtinNot an arrayPossible syntax errorCall to undefined function%s:%i: %s%d diouxXeEfgG%a %b %d %H:%M:%S %Z %YRSTARTRLENGTH,ALAhAA4A8AAA$AAAwpopenarBlBB~hCR(window resize)(hangup)(interrupt)(terminate)(bus error)(I tried to touch invalid memory)(alarm)-- caught signal %d %s--%d%n=%ddeleteeditNo write since last change (:edit! overrides)No current filename"%s" is not a regular file"%s" is not readable [New file] [Read only]"%s"%s%s %dL, %dCfileNo address allowed on this commandfeatureslist $ quitnextNo write since last change (:%s! overrides)%d more file to editNo more files to editreadNo filename given"%s"%s %dL, %dCrewindNo write since last change (:rewind! overrides)set---------------------------------------- noautoindent flash ignorecase showmatch tabstop=%d aiflic=%dsversion%swritewqx"%s" File is read only"%s" %dL, %dCyankYank %d lines (%d chars) into [%c]:s expression missing delimiters[Hit return to continue] )]}cdy><^%$0bBeEftwWH-k{L+j} can't create room for new characterscan't delete the characterThese features are available: Pattern searches with / and ? Last command repeat with '.' Line marking with 'x Named buffers with "x Readonly if vi is called as "view" Readonly with -R command line arg Some colon mode commands with ':' Settable options with ":set" Signal catching- ^C Job suspend and resume with ^Z Adapt to window re-sizesPut %d lines (%d chars) from [%c]OAOBOCODOHOF[A[B[C[D[H[F[1~[2~[4~[5~[6~OPOQOROS[15~[17~[18~[19~[20~[21~[23~[24~[11~[12~[13~[14~last_modifying_cmd overrun Trying to insert a negative number (%d) of charactersTrying to insert file outside of memory"%s" %scould not open filecould not read file "%s"could not read all of file "%s"'%s' is not implementedNo file [modified]"%s"%s%s line %d of %d --%d%%--Nothing in register %c()[]{}No previous regular expressionPattern not foundsearch hit BOTTOM, continuing at TOPsearch hit TOP, continuing at BOTTOM :-- Insert ---- Replace --^0bBeEft$cdykjHL%+-{} ChangeDeleteYank%s %d lines (%d chars) using [%c]"CBBB(B0B?exec -c Starting pid %d, console %s: '%s'Bummer, could not run '%s': %mThe system is going down NOW !!Sending SIGTERM to all processes.Sending SIGKILL to all processes.exec of '%s' failed: %mThe system is halted. Press Reset or turn off powerPlease stand by while rebooting the system.Memory allocation failureSorry, your computer does not have enough memory./etc/inittabr/sbin/reboot/bin/umount -a -r/sbin/init/dev/vc/2/dev/vc/3/dev/vc/4/etc/init.d/rcS/dev/Bad inittab entry: %sReloading /etc/inittab-q/init started: %ssingle-s1initProcess '%s' (pid %d) exited. Scheduling it for restart.d:/var/spool/cron/crontabsf-b:b-f:S-L:L-Sl:L:fbSc:%sdaemon %s 2.3.2 dillon, started, log level %d Itime disparity of %d minutes detected USER failed to get uid for %sHOMESHELL %s for user %s chdir failed: %s: %m/var/spool/cronsunmontuewedthufrisatSunMonTueWedThuFriSatjanfebmaraprmayjunjulaugsepoctnovdecJanFebMarAprMayJunJulAugSepOctNovDecIfailed user %s parsing %s rootrIMaximum number of lines reached for user %s cron.update unable to find %s .ignoring %s Unable to open current dir!  process already running: %s %s USER %s pid %3d cmd %s couldn't fork, user %s -cunable to exec, user %s cmd %s -c %s /var/spool/cron/crontabsuser %s unknownonly the superuser may specify a user-c option: superuser onlygetpwuidunable to read replacement filecannot change dir to %srno crontab for %s/var/spool/cron/crontab.%dunable to create %s%s.newunable to create %s/%s%s cron.updateaunable to append to %s/%sCCCCCCCCCCCCCCCCCCԜCLC4ChCC4Cpipeforkunable to open %sVISUAL/bin/vi%s %s-cexecUSERfailed to get uid for %sHOMESHELLchdir failed: %s %s%s: afon:{%s}: r%7lo %sreal %E user %u sys %Treal %e user %U sys %S Command being timed: "%C" User time (seconds): %U System time (seconds): %S Percent of CPU this job got: %P Elapsed (wall clock) time (h:mm:ss or m:ss): %E Average shared text size (kbytes): %X Average unshared data size (kbytes): %D Average stack size (kbytes): %p Average total size (kbytes): %K Maximum resident set size (kbytes): %M Average resident set size (kbytes): %t Major (requiring I/O) page faults: %F Minor (reclaiming a frame) page faults: %R Voluntary context switches: %w Involuntary context switches: %c Swaps: %W File system inputs: %I File system outputs: %O Socket messages sent: %s Socket messages received: %r Signals delivered: %k Page size (bytes): %Z Exit status: %xwrite errorCommand stopped by signal %d Command terminated by signal %d Command exited with non-zero status %d %ld%lu%lu%%?%%%ldh %ldm %02lds%ldm %ld.%02lds%ld.%02ld%d CDCDCDCDCDCDCDCDCDCDCDCDCDCDCDCDCDCDCDCDCDCDCDCDCDCDCDCDCDCDCDCDCDCDCDCDCCDCDCDCDCDCDCDCDCDCDCDCDCDCDCDCDCDCDCDCDCDCDCDCDCDCDCDCDCDCCIJCHCpCDCDC|CDCCDC\CDCCCDCCC4C\CDCCCDCȶCDCDCDCDCDCDCDCDCCDCCDCDCDCDCDC@CDCDCDCDCLCDCtCCCtCDCCCcannot forkcannot run %serror waiting for child process$Id: insmod.c,v 1.118 2004/05/26 11:38:46 andersen Exp $$Id: insmod.c,v 1.118 2004/05/26 11:38:46 andersen Exp $ Warning: unhandled reloc %d CdC4CdCHCCC%s multiply definedlocal symbol %s with index %ld exceeds local_symtab_size %ld.initGPLONLY_.modinfoparm_invalid parameter %ssymbol for parameter %s not foundimproperly terminated string argument for %sparameter type 'c' for %s must be followed by the maximum sizestring too long for %s (max %ld)unknown parameter type '%c' for %stoo many values for %s (max %d)invalid argument syntax for %stoo few values for %s (min %d)@C@C@C@C@C@C@C@CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC CCCCCCCC(CCCC0CC8CCCCCCCCCCtCtCCCtCCCCCCCCCCCCCCCCCCCtCCCCCCCCCCCCCQM_MODULESquery_module: QM_INFO: %squery_module: QM_SYMBOLS: %skernel: QM_SYMBOLSUsing_Versions.this__this_module.kmodtab__ksymtabcorrupt module %s?init_modulecleanup_module__ex_table.text.init.data.init__dbe_table__kallsymsinit_module: %s.kstrtabunresolved symbol %s.bssRelocation overflowDangerous relocationUnhandled relocation%s of type %ld for %s%s of type %lderror reading ELF headernot an ELF fileELF file not for this architectureELF file not a relocatable objectsection header size mismatch: %lu != %luerror reading ELF section headerscan't handle sections of type %ldsymbol size mismatch: %lu != %lurelocation entry size mismatch: %lu != %luerror reading ELF section dataRELA relocations not supported on this architectureLCtCCCC8C8CLCLCCkernel_versionGPLGPL v2GPL and additional rightsDual BSD/GPLDual MPL/GPLlicenseWarning: loading %s will taint the kernel: %s%s See %s for information about tainted modules http://www.tux.org/lkml/#export-tainted%d /proc/sys/kernel/taintedno licensenon-GPL license - Unexpected return from obj_gpl_licenseforced loadSections: Size %-*s Align Address%-15s %08lx %0*lx 2**%d Symbols:%0*lx %c %s fkqsvxmLo:%s.or/lib/modules%s: no module by that name foundUsing %s Could not load the moduleNot configured to support old kernelsA module named %s already existsCan't allocate kernel memory for module; needed %lu bytescreate_module: %sDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDdDD0DDDDDDDLD/proc/sys/kernel/taintedr%d Tainted: %c%c%c Not tainted@QM_MODULESModule Size Used bymodule %s: QM_INFOmodule %s: QM_REFS%-20s%8lu%4ld (deleted) (initializing) (uninitialized) (autoclean) (unused) [%s%s rmmodQM_MODULESa%scmd %s%s%s%s %s fgets()r+Couldnt open control streamUSER %sPASS PASS error: %sUSER error: %sTYPE IPASVPASV error: %sCWD CWD error: %sALLO %luALLO error: %sSTOR STOR error: %serror: %sQUITcontinueverboseusernamepasswordportftpanonymousbusybox@cvu:p:P:tcpConnecting to %s[%s]:%d you must be root to change the hostnamesethostnamerdfisF:%s "D"D"D"D"D"D"D"D"D"D"D"D"D"D"D"D"D"D"D"D"D"D"D"D"D"D"D"D"D"D"D"D"D"D"D"D"D"D"D"D"D"D"D"D"D"DSIOCSIFMETRICSIOCSIFMTUSIOCSIFTXQLENSIOCSIFDSTADDRSIOCSIFNETMASKSIOCSIFBRDADDRSIOCSIFADDRmetricmtutxqueuelendstaddrnetmaskbroadcastpointopointarptrailerspromiscmulticastallmultidynamicupdownsocketSIOCGIFFLAGSSIOCSIFFLAGSaddressroutelinktcplp:i:e:socketreuseaddr failedbindlistenacceptconnectselectreadwriteESTABLISHEDSYN_SENTSYN_RECVFIN_WAIT1FIN_WAIT2TIME_WAITCLOSECLOSE_WAITLAST_ACKLISTENCLOSING*:%d: %64[0-9A-Fa-f]:%X %64[0-9A-Fa-f]:%X %X %lX:%lX %X:%lX %lX %d %d %ld %512s %Xwarning, got bogus tcp line.tcptcp %6ld %6ld %-23s %-23s %-12s warning, got bogus udp line.UNKNOWNudpudp %6ld %6ld %-23s %-23s %-12s warning, got bogus raw line.rawraw %6ld %6ld %-23s %-23s %-12s Inode%p: %lX %lX %lX %X %X %d %swarning, got bogus unix line.%dunix??STREAMDGRAMRAWRDMSEQPACKETFREELISTENINGCONNECTINGCONNECTEDDISCONNECTING[ ACC W N ]%-5s %-6ld %-11s %-10s %-13s %-6d - <@D(@DP@Dd@Dx@D@D@D AD AD4ADrno support for `%s' on this system.laenrtuwxActive Internet connections (servers and established)(only servers)(w/o servers) Proto Recv-Q Send-Q Local Address Foreign Address State /proc/net/tcpAF INET (tcp)/proc/net/udpAF INET (udp)/proc/net/rawAF INET (raw)Active UNIX domain sockets Proto RefCnt Flags Type State I-Node Path/proc/net/unixAF UNIXEDEDEDED`EDEDEDEDEDEDEDDDED(EDEDEDEDXEDEDhEDpEDEDxEDED%d.%d.%d.%dAddresses: Address: %s , %s %s *** Unknown hostServer:Name: 8<L  --- %s ping statistics --- %ld packets transmitted, %ld packets received, %ld duplicates, %ld%% packet loss round-trip min/avg/max = %lu.%lu/%lu.%lu/%lu.%lu ms sendtoping wrote %d chars; %d expectedEcho ReplyDestination UnreachableSource QuenchRedirect (change route)Echo RequestTime ExceededParameter ProblemTimestamp RequestTimestamp ReplyInformation RequestInformation ReplyAddress Mask RequestAddress Mask Replyunknown ICMP typeUDVDVD VD VD4VDVDVDHVDVDVD\VDpVDVDVDVDVDVDVD%d bytes from %s: icmp_seq=%u ttl=%d time=%lu.%lu ms (DUP!)Warning: Got ICMP %d (%s)unknown address type; only AF_INET is currently supported.PING %s (%s): %d data bytes recvfrom#net#host metric netmaskgw gatewaymss windowirttdev device reject!mod"dyn #reinstate resolving %sgateway %s is a NETWORKlonetmask %.8x and host route conflictbogus netmask %snetmask and route address conflictsocketSIOC[ADD|DEL]RT GHRDM/proc/net/router MSS Window irttMetric Ref UseKernel IP routing table Destination Gateway Genmask Flags %s Iface %*[^ ] %63s%lx%lx%X%d%d%d%lx%d%d%d fscanf%-16s%-16s%-16s%-6s%5d %-5d %6d %s %-6d %-2d %7d %s adddeldelete-net-hostA:neinet/etc/issue.net/dev/ptmxAll network ports in use!Can`t forkingCould not open ttyexecv errori:f:l:p:'%s' unavailable.socketbindlistendaemonUndefined errorFile not foundAccess violationDisk full or allocation errorIllegal TFTP operationUnknown transfer IDFile already existsNo such userbad blocksizeb:gpl:r:-local fileudpDTDTDTDTDDTDTDTDTDDTDTDTDDTD0Dsocketreadwritetoo long remote-filenamesendoctetblksize%drecvfromtimeoutlast timeoutselectserver says: %sbad server optionwarning: blksize not supported by server - reverting to 512sendtotraceroute: wrote %s %d chars, ret=%d max ttl must be >1.port must be >0.nprobes must be >0.tos must be 0 to 255.wait must be >1 sec.dm:np:q:rs:t:w:vpacket size must be 0 <= s < %d.SO_SNDBUFIP_HDRINCLunknown host %straceroute to %s (%s) from %s, %d hops max, %d byte packets %2d %g ms ! !N !H !P !F !S *|DԓDԓDԓDԓDԓDԓDԓDԓDDDԓD0DDDȒDܒDԓD|D DPDdDxDDDD %s %s (%s)@@ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789+/buffer overflowcontinuequietpassive-ftpoutput-documentheaderdirectory-prefixproxyon*cqO::P:Y:offextra_headers buffer too small(need %i)ftp_proxyhttp_proxyindex.htmlcannot specify continue (-c) without a filename (-O)-awfstat()Connecting to %s[%s]:%d too many redirectionsfhtGET %stp://%s:%d/%s HTTP/1.1 GET /%s HTTP/1.1 Host: %s User-Agent: Wget Authorization: Basic %s Proxy-Authorization: Basic %s Range: bytes=%ld- Connection: close no response from serverserver returned error %d: %stransfer-encodingcontent-length %s is garbagechunkedserver wants to do %s transfer encodinglocationcontent-lengthanonymous:busybox@%sUSER PASS ftp login: %sCDUPTYPE ISIZE /SIZE value is garbagePASVPASV: %sREST %ldRETR /RETR: %swrite errornetwork read errorftp error: %sQUIThttp://httptcpftp://ftptfpnot an http or ftp url: %sr+fdopen()bad header line: %s%s%s fgets() KMGTP %-20.20s %3d%% **********************************************************************************************************************************************************|%.*s%*s| %5d %c%c - stalled - --:-- ETA%2d: %02d:%02d ETAY@.A---familyinetinet6linkinvalid protocol family-4-6-0-oneline\ ,LOOPBACK%sBROADCAST%sPOINTOPOINT%sMULTICAST%sNOARP%sUP%s%x,M-DOWN> SIOCGIFXQLENqlen %dnil ifnameDeleted %d: %s@NONE: @%s: : mtu %u qdisc %s master %s link/%s peer brd Failed to send flush request wrong nlmsg len %d%u: %s inet inet6 family %d /%d peer %s/%d brd %s any %s scope %s secondary tentative deprecated dynamic flags %02x valid_lft forevervalid_lft %dsec preferred_lft forever preferred_lft %dsec %stoscopeuplabeldevFlush requires arguments. Cannot flush link addresses. allinvalid "scope" Device "%s" does not exist.Cannot send dump requestFlush terminated Dump terminated`DDDDDpeerremotebroadcastbrdanycastlocal+-invalid scope value.Not enough information: "dev" argument is required."dev" (%s) must match "label" (%s).Broadcast can be set only for IPv4 addressesCannot find device "%s"8D8DDDDpDDDPDadddeletelistshowlstflushUnknown command %sDDDDDDError: argument of "%s" must be "on" or "off"Cannot create control socketSIOCGIFFLAGSSIOCSIFFLAGSSIOCSIFNAMESIOCSIFXQLENSIOCSIFMTUsocket(PF_PACKET)SIOCGIFINDEXbindgetsocknameWrong address (%s) length: expected %d bytesSIOCSIFHWBROADCASTSIOCSIFHWADDRupdownnamemtuInvalid "mtu" value multicastonoffarpnoarpdevNot enough of information: "dev" argument is required.setshowlstlistCommand "%s" is unknown.Failed to send flush request Not a route: %08x %08x %08x wrong nlmsg len %dDeleted %s %s/%u 0/%d default from %s/%u from %s from 0/%u via %s dev %s src %s metric %d %s cache expires %dsec error %d iif %ssrcviamtulock"mtu" value is invalid protocol"protocol" value is invalid devoiftoCannot find device "%s"/proc/sys/net/ipv4/route/flush-1Cannot open "%s" Cannot flush routing cache "ip route flush" requires arguments. allinvalid "protocol" iiffromrootmatchexactNothing to flush. Cannot send dump requestDump terminatedFlush terminated notifyconnectedneed at least destination addressNot a route?Wrong len %dFailed to connect the routeAn error :-)4E4E4E4E4E4E4EaddappendchangechgdeletedelgetlistshowprependreplacetestflushUnknown command %s(:E0:E8:E8:E@:E@:EH:Et:Et:E:E:E:E:ECannot open netlink socketCannot bind netlink socketCannot getsocknameWrong address length %dWrong address family %dOVERRUNEOF on netlinksender address length == %dERROR truncatedRTNETLINK answersMessage truncated!!!Remnant of size %dCannot talk to rtnetlinkTruncated message!!!malformed message: len=%dUnexpected reply!!!Sender address length == %d!!!malformed message: len=%d @%lurtnl_from_file: freadrtnl-from_file: truncated message!!!Deficit %d, rta_len=%d%02x:%02x"%s" is invalid lladdr.%x*if%dCannot send dump requestDump terminated genericethereetherax25pronetchaosieee802arcnetatalkdlciatmmetricomieee1394slipcslipslip6cslip6rsrvdadaptrosex25hwx25ppphdlclapbddcmprawhdlcipiptunnel6fradskiploopbackltalkfddibifsitip/ddpgrepimreghippiasheconetirdafcppfcalfcplfcfb0fcfb1fcfb2fcfb3fcfb4fcfb5fcfb6fcfb7fcfb8fcfb9fcfb10fcfb11fcfb12trieee802.11void[%d]r0x%x %s 0x%x %s #%d %s %d %s #Database %s is corrupted at %s noneredirectkernelbootstaticgatedramrtzebrabird/etc/iproute2/rt_protos%dglobalnowherehostlinksite/etc/iproute2/rt_scopesunknown/etc/iproute2/rt_realmsunspeclocalmain/etc/iproute2/rt_tables0/etc/iproute2/rt_dsfield0x%02xnoneunicastlocalbroadcastanycastmulticastblackholeunreachableprohibitthrownatxresolve%dlE mE mE4mEHmE\mEpmEmEmEmEmEmEbrddefaultallany"%s" may be inet address, but it is not allowed in this context.an inet address is expected rather than "%s".an IP address is expected rather than "%s"Command line is not complete. Try option "help"argument "%s" is wrong: %sduplicate "%s": "%s" is the second value.either "%s" is duplicate, or "%s" is a garbage./proc/net/pschedr%*08x%*08x%08x%08x???freeshared%6s%13s%13s%13s%13s%13s totalusedbuffers%6s%13ld%13ld%13ld%13ld%13ld Mem:%6s%13ld%13ld%13ld Swap:Total:killallkillall5%2d) %-16sbad signal name '%s'Bad PID '%s'Could not kill pid '%d'%s: no process killedCould not kill pid '%ld's%s%ld O PID Uid VmSize Stat Command%5d %-8s %s %5d %-8s %6ld %s [%s] %d: old priority %d, new priority %d %d: setpriority/proc/sys//etc/sysctl.conferror: Unknown parameter '%s' error: Malformed setting '%s' error: '%s' must be of the form name=value error: '%s' is an unknown key error: unknown error %d setting key '%s' error: unknown error %d reading key '%s' error: permission denied on key '%s' error: unable to open directory '%s' error: unable to open preload file '%s' warning: %s(%d): invalid syntax, continuing... EEDEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEDEEEEEEEEEEEEEАEEEEEEEEEؐEr= %s%.*s = uptimestat/proc not be mounted?cpu %lu %lu %lu %lu%srmeminfoMemTotal: %lu %s Mem: %lu %lu %lu %lu %lu %luMemFree: %lu %s MemShared: %lu %s Buffers: %lu %s Cached: %lu %s loadavg%f %f %ffailed to read '%s'Mem: %ldK used, %ldK free, %ldK shrd, %ldK buff, %ldK cached Load average: %.2f, %.2f, %.2f (State: S=sleeping R=running, W=waiting)  PID USER STATUS RSS PPID %%CPU %%MEM COMMAND %6ldM%7ld%5d %-8s %s %s %5d %2d.%d %2u.%u d:/procchdir('/proc')scandir('/proc')? %02d:%02d:%02d up %d day%s, s%2d:%02d, %d min, load average: %ld.%02ld, %ld.%02ld, %ld.%02ld %s: not found %s @=Illegal number: %sHOMEend of filenewlineredirectionword;&&&|||();;`!casedodoneelifelseesacfiforifinthenuntilwhile{}%s%c      !"$&'()*-/:;<=>?[\]`|}~   3.3:6alias2bg3break2cd0chdir2command3continue3eval3exec3exit7export2false2fg2getopts0hash0help2jobs2kill0let4local0pwd2read7readonly3return3set3shift3times3trap2true0type0ulimit2umask2unalias3unset2waitPATH=/usr/local/bin:/usr/bin:/sbin:/binIFS= PS1=$ PS2=> PS4=+ OPTIND=1eerrexitfnoglobIignoreeofiinteractivemmonitornnoexecsstdinxxtracevverboseCnoclobberaallexportbnotifyunounsetqquietprofile%s: %s not found aliasaunalias%s=%s LPOLDPWD.CDPATHcan't cd to %sPWD%s: %s: %d: E>|>>>&<<&<>F|FFFFF FFFFFF(F|F`FFpFFFFFFԈFFFdF}-+?=%%%### "$(...)"$((${#${"}$(...))) | %sCannot set tty process group (%m)PS1=\w \$ %dPPID/etc/profile.profileENV Use "exit" to leave shell. '̭FXFFFFFFF̭FFFFF̭FFFpFpFpFpFpFdFdFpFpFF\FدFFFFFFF\FFF4FF\FFFFFFFF԰F԰FFFDF-c requires an argumentCurrent option settings %-16s%s onoffIllegal option -o %sloginIllegal option -%ccan't shift that manyOPTARGIllegal option -%c No arg for -%c option OPTINDUsage: getopts optstring var [arg]No arg for -%c optionBad for loop variableFFFFFFF,FFFFFFFFFFFF0FFFFFFFBad function nameBad fd numberIllegal eof marker for << redirection ()&|;  }-+?=Missing '))'Unterminated quoted stringMissing '}'Bad substitutionEOF in backquote substitutionG FFDFdFtFF`FFF F>=<< >>,||&&!=*<=k>=K== |=B&="*=/=#%=C+=-=--3^=b++**/!0< >+=|& */.%N+ --^~,?:$)4(sh: turning off NDELAY mode /dev/null%lld[%dD[%dA[%dC?%dkGlGlGHjGlGlGlGlGlGlGlGlGlGlGlGlGlGlGlGlGlGlGlGlGlGlGlGlGlGlGlGlGlGlGlGlGkGlGlGlGlGlGlGlGlGlGlGlGlGlGlGlGlGlGPkGkGlGlGlGlGlGlGlGlGlGlGlGlGkGlGlGiGlGlGlGlGlGlGlGlGlGlGlGlGhiGlGhjGkG `"#$%^&*()=+{}[]:;'|\<>. %*s./../GЙGdGGGG\GԔG|G@GGXG@GG\GG\G\G\G\GG\GG\G\G\GG\G\G\G\G\G\G\G\G\G\G\G\G\G\G\G\G\G\G\G\G\G\G\G\G\G\G\G\G\G\G\G\G\G\G\G\G\G\G\G\G\G\G\G\G\G\G\G\G\G\G\G\G\G\G\G\G\G\G\G\G\G\G\G\G\G\G\G\G\G\G\G\G\G\G\G\G\G\G\G\G\G\G\G\G\G\G\G\G\G\G\G\G\G\G\G\G\G\G\GԔG|G8G8G8G8G8G8G8G8G8G8G8G8G8G8G8G8G8G8G8G8G8G8G8G8G8G8G8G8G8G8G8G8G8G8G8G8G8G8G8GG8GؙGG8G8G8G8G8G8G8G8G8G8G8G8GGGGЙG8GG8GGKernel log daemon exiting.kernelklogd started: BusyBox v1.00-pre10 (2004.10.06-20:02+0000)klogd: Error return from sys_sycall: %d - %m. c:ndaemonunknown facility name: %sunknown priority name: %sp:st:%s GENA-fCan't find circular bufferCan't get access to circular buffer from syslogdCan't get access to semaphone(s) for circular buffer from syslogdsemop[SMrdn]semop[SMrup]%salertcritdebugemergerrerrorinfononenoticepanicwarnwarningauthauthprivcrondaemonftpkernlprmailmarknewssecuritysysloguseruucplocal0local1local2local3local4local5local6local7/var/log/messagesGENAExiting Syslogd!shmgetshmatsemgetBuffer already allocated just grab the semaphore?semop[SMwdn]Weird! Can't find the terminator token??? Weird! Can't find the terminator token from the beginning??? semop[SMwup]/dev/consoleBummer, can't print: <%d>%s.%s%s %s %s %s %s %s System log daemon exiting.-- MARK --cannot create socketcannot connect to remote host %s:%d/dev/logCouldn't get file descriptor for socket /dev/logCould not connect to socket /dev/logCould not set permission on /dev/logsyslogd started: BusyBox v1.00-pre10 (2004.10.06-20:02+0000)select errorUNIX socket errorm:nO:s:Sb:R:LC::GlGlGlGlGlGlGlGlGGlGlGGlGlG$GPGlGlGlGlGlGlGlGlGlGlGlGlGlGlGlGlGlGlGlGlGlGlGlGlGlGGGcn:s:r"%07.7_ax " 16/1 "%03o " "\n""%07.7_ax " 16/1 "%3_c " "\n""%07.7_ax " 8/2 " %05u " "\n""%07.7_ax " 8/2 " %06o " "\n""%07.7_ax " 8/2 " %04x " "\n""%07.7_Ax "bcdoxe:f:n:s:vbkm"%07.7_ax " 8/2 "%04x " "\n"/dev/ttyr/dev/console--More-- (%d%% of %ld bytes)asyncatimedefaultsnoautodevdiratimeexecnoatimenodevnodiratimenoexecnosuidremountrorwsuidsyncbindmove%s is write-protected, mounting read-only,auto/etc/filesystemsr/proc/filesystemsMounting %s on %s failed/dev/root%s on %s type %s (%s) rootfso:rt:wafnv/etc/fstab Cannot read /etc/fstabswapCan't find %s in /etc/fstab GGGGGGGGGGGGGG|GGGGGGGGG~timeout connecting to time servertcptime%s did not send the complete timespCurrent time matches remote time.Could not set time of day%s rCannot open %srootfs/dev/rootforced umount of %s failed!%s busy - remounted read-onlyCannot remount %s read-onlyproc%sCouldn't umount %s on %s: %s unable to stat `%s'm:bb_xasprintfcannot set groupscannot set group idcannot set user id%s/%s%s%s%sunable to stat `%s'`%s' and `%s' are the same file%s: omitting directory`%s' is not a directorycannot create directory `%s'unable to open directory `%s'unable to change permissions of `%s'unable to link `%s'unable to open `%s'overwrite `%s'? unable to remove `%s'unable to close `%s'internal error: unrecognized file typeunable to create `%s'cannot create fifo `%s'cannot create symlink `%s'unable to preserve ownership of `%s'unable to preserve times of `%s'unable to preserve permissions of `%s'Unable to read all dataRead erroricmp.#-+ 0123456789cdiouxXeEfgGdiouxXbad byte count for conversion character %s.eEfgG%%s requires a precision or a byte count.bad conversion character %%%s. hexdumpbyte count with multiple conversion characters. %srstdin* -0+#\0\a\b \b \n \r \t \v%03onulsohstxetxeotenqackbelbs_ht_lf_vt_ff_cr_so_si_dledcldc2dc3dc4naksynetbcanem_subescfs_gs_rs_usdelbad format {%s}r/could not stat '/'/devcould not open '/dev'/dev/rootxjVp $ν|*ƇGF0FؘiD[\"kqCy!Ib%@@QZ^&Ƕ]/SD!7Ç ZEogL*B9q"am 8D꾤K`Kp~('09|eVD")*C#9Y[e }]O~o,CN~S5:*ӆ                  0kMGT%Lu%Lu.%d%cdefault*[NONE SET]inetDARPA Internet%02X-unspecUNSPEC/proc/netNo usable address families found.warning: no inet socket availableSIOCGIFCONF%n%Lu%u%u%u%u%n%n%n%Lu%u%u%u%u%u%Lu%Lu%u%u%u%u%n%n%Lu%Lu%u%u%u%u%u%Lu%Lu%u%u%u%u%u%u%Lu%Lu%u%u%u%u%u%u/proc/net/devrWarning: cannot open %s. Limited output.compressedbytesDevice not found%s: error fetching interface information: %s loopLocal Loopback%02X:%02X:%02X:%02X:%02X:%02XetherEthernetpppPoint-Point Protocolunknown10base210baseTAUI100baseT100baseTX100baseFXKiMiGiTiX bytes:%Lu (%Lu.%u %sB)%sUP BROADCAST DEBUG LOOPBACK POINTOPOINT NOTRAILERS RUNNING NOARP PROMISC ALLMULTI SLAVE MASTER MULTICAST  @%-9.9s Link encap:%s HWaddr %s Media:%s(auto) %s addr:%s P-t-P:%s Bcast:%s Mask:%s [NO FLAGS] MTU:%d Metric:%dRX packets:%Lu errors:%lu dropped:%lu overruns:%lu frame:%lu compressed:%lu TX packets:%Lu errors:%lu dropped:%lu overruns:%lu carrier:%lu collisions:%lu compressed:%lu txqueuelen:%d R T Interrupt:%d Base address:0x%lx Memory:%lx-%lx DMA chan:%x socketcannot get system information.%A, %d %B %Y%H:%M:%S rsHltHltHltHltHltHltHltHltHltHltHltHltHltHltHltHltHltHltHltHltHltHltHltHltHltHltHltHltHltHltHltHsHltHltHltH@tHltHltHltHdtHsH|sHsHltHltHsHtsHsHltHsH login: createset permissions ofCannot %s directory `%s'?pc?d?b?-?l?s???rwxSTst/proc/mounts%ldunknown group name: %sunknown user name: %sunknown user name: %sunknown gid %ld%ld 8$II augorwxXstinvalid number `%s'rabfnrtv\ \\/procCan't open /proc/proc/%d/proc/%d/statr%*s (%15c%c %d %*s %*s %*s %*s %*s %*s %*s %*s %*s %lu %lu %*s %*s %*s %ld %*s %*s %*s %*s %ld/proc/%d/cmdline%sunable to stat `%s'cannot remove `%s'%s: is a directory%s: descend into directory `%s'? unable to open `%s'unable to close `%s'%s: remove directory `%s'? %s: remove `%s'? unable to remove `%s'failed to open directory %sfailed to stat component %sfailed to forkfailed to exec %s%s exited with return code %d%s exited because of uncaught signal %dcomponent %s is not an executable plain file EXITHUPINTQUITILLABRTFPEKILLSEGVPIPEALRMTERMUSR1USR2CHLDCONTSTOPTSTPTTINTTOUTRAPIOTEMTBUSSYSURGIOPOLLCLDXCPUXFSZVTALRMPROFPWRWINCHSIG%d%s: : %s%s %sUnable to connect to remote host (%s)getcwd()%sP%sxregcomp: %sr2Kn,X   `  %Kignoring all argumentsBusyBox v1.00-pre10 (2004.10.06-20:02+0000) multi-call binarymemory exhaustedinvalid date `%s'%s: input/output error -- %mWrite ErrorNames longer than %d chars not supported.(unknown)can`t create raw socketpermission denied. (are you root?)standard inputstandard output-/bin/shbb_xstrndup bug%s%sRead errorShort read%s: ;{{{6PIBTIEGXIB\I@>AhIx@pIq@xIx@Ip?AIAAIKBICAIFAIP{@ID7DIRD#ISAI[AIbAI jAIpnAIHIsAIvAICI yAI{AIPAICICI7FID IC(I}@0Iė@8IpA@I\HHIAPI D\IA`IDlI.DtID|IAIDI:FI:FI:FITXHIpAI AI[HIAI _HI AIILTP|}~<EITL|}~@JABCDEFKGHIHPo@@o@8D0o@ o@0oIo@o@3I`#Fn@06@ FLB5n@AAAp@NI`j@HPj@@j@7I0j@ j@gIj@j@i@i@i@i@@5Bi@6i@Ai@P2IH@q@i@pi@`i@(\EPi@@@i@ F0=AsI0i@A i@&IHA0p?A0@A0AA@@CA CAhFAXHAIA8